BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40172 (788 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 3.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.9 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -1 Query: 386 KHIQQYVLFHLQLHN*VGAKKVHGRSNI 303 K+I + HL++H+ G +HG I Sbjct: 313 KYITPLIQKHLKIHDTCGVHNLHGMPGI 340 Score = 22.2 bits (45), Expect = 5.7 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -3 Query: 783 GKLLITIINTGDINCLIQI*FLNYLSHAVSFIINCKSTQISHH 655 G+ L+ ++ GD + + F Y A+SF+ K + HH Sbjct: 161 GEHLLMTVDAGD-SMFVHT-FGAYFGLAISFVFGMKEKRKEHH 201 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 416 NRHGHITSLAVKRSHR 463 N H H+ S AV+ HR Sbjct: 146 NHHHHLQSTAVQDHHR 161 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,949 Number of Sequences: 438 Number of extensions: 3954 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24882285 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -