BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40171 (623 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 26 1.1 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 25.8 bits (54), Expect = 1.1 Identities = 24/94 (25%), Positives = 35/94 (37%), Gaps = 8/94 (8%) Frame = +2 Query: 128 RMVFGIAGTIHKRNNGTHEQ*IYREYYNGIS*KKILYF--------SREISPVRSSYGMT 283 R F G H R+N T + + N + +ILY RE + Y + Sbjct: 521 RKRFAGGGHSHHRSNDTTDALCGLIFCNNRAMARILYVLLYEVSRSQREFEFISPQYTVD 580 Query: 284 TVISAYLLCAKNIESQQRKQENILKPLIKRSLNM 385 V + C K + RKQE +LK N+ Sbjct: 581 KVATNPQNCLKQTTIEHRKQEEVLKRFRMHECNL 614 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 667,013 Number of Sequences: 2352 Number of extensions: 13618 Number of successful extensions: 19 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -