BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40170 (639 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 25 0.82 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 25 0.82 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 25 0.82 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 24 1.1 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 23 1.9 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 23 1.9 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 23 1.9 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 5.8 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 7.6 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 7.6 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 24.6 bits (51), Expect = 0.82 Identities = 7/25 (28%), Positives = 20/25 (80%) Frame = -1 Query: 405 TRHYLTVVN*EGYREYILSMVLESS 331 +++Y+T+++ G+R++I +M+ +S Sbjct: 10 SKYYVTIIDAPGHRDFIKNMITGTS 34 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 24.6 bits (51), Expect = 0.82 Identities = 7/25 (28%), Positives = 20/25 (80%) Frame = -1 Query: 405 TRHYLTVVN*EGYREYILSMVLESS 331 +++Y+T+++ G+R++I +M+ +S Sbjct: 26 SKYYVTIIDAPGHRDFIKNMITGTS 50 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 24.6 bits (51), Expect = 0.82 Identities = 7/25 (28%), Positives = 20/25 (80%) Frame = -1 Query: 405 TRHYLTVVN*EGYREYILSMVLESS 331 +++Y+T+++ G+R++I +M+ +S Sbjct: 83 SKYYVTIIDAPGHRDFIKNMITGTS 107 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 24.2 bits (50), Expect = 1.1 Identities = 7/24 (29%), Positives = 19/24 (79%) Frame = -1 Query: 402 RHYLTVVN*EGYREYILSMVLESS 331 ++Y+T+++ G+R++I +M+ +S Sbjct: 84 KYYVTIIDAPGHRDFIKNMITGTS 107 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 1.9 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = +2 Query: 128 ILSSSRDKTLIV---WKLTRDENNYGIPQKRLYGHSHFISDVVLSMTVITHFPVLGTRLC 298 I+SS +KT+ +K + NNY K+LY + ++I + + + V ++ R Sbjct: 81 IISSLSNKTIHNNNNYKYNYNNNNYNNNCKKLYYNINYIEQIPIPVPV--YYGNFPPRPM 138 Query: 299 VCGISLQARLP 331 IS+Q ++P Sbjct: 139 GPWISMQEQIP 149 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 1.9 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = +2 Query: 128 ILSSSRDKTLIV---WKLTRDENNYGIPQKRLYGHSHFISDVVLSMTVITHFPVLGTRLC 298 I+SS +KT+ +K + NNY K+LY + ++I + + + V ++ R Sbjct: 81 IISSLSNKTIHNNNNYKYNYNNNNYNNNCKKLYYNINYIEQIPIPVPV--YYGNFPPRPM 138 Query: 299 VCGISLQARLP 331 IS+Q ++P Sbjct: 139 GPWISMQEQIP 149 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 1.9 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = +2 Query: 128 ILSSSRDKTLIV---WKLTRDENNYGIPQKRLYGHSHFISDVVLSMTVITHFPVLGTRLC 298 I+SS +KT+ +K + NNY K+LY + ++I + + + V ++ R Sbjct: 81 IISSLSNKTIHNNNNYKYNYNNNNYNNNCKKLYYNINYIEQIPIPVPV--YYGNFPPRPM 138 Query: 299 VCGISLQARLP 331 IS+Q ++P Sbjct: 139 GPWISMQEQIP 149 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.8 bits (44), Expect = 5.8 Identities = 12/56 (21%), Positives = 27/56 (48%) Frame = +2 Query: 164 WKLTRDENNYGIPQKRLYGHSHFISDVVLSMTVITHFPVLGTRLCVCGISLQARLP 331 +K + NNY K+LY + ++I + + + V + +R + +Q ++P Sbjct: 96 YKYNYNNNNYNNNCKKLYYNINYIEQIPVPVPVPIYCGNFPSRPMGPWVPMQEQIP 151 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.4 bits (43), Expect = 7.6 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +3 Query: 519 NPIIVSCGWDRTVKVWHLTNW 581 NPI V WD+ V+ L W Sbjct: 329 NPICVQIPWDKNVEA--LAKW 347 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.4 bits (43), Expect = 7.6 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = -2 Query: 467 SWMVYLHSARVFQSLIVLSREPDTI*RLSTEKATESTSLVW 345 SW + +F L++L+ +++ LS + ST+L W Sbjct: 2 SWQRVFLAVGLFGVLLLLTNADNSVHILSKYQLITSTTLNW 42 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,759 Number of Sequences: 438 Number of extensions: 4421 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -