BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40164 (728 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25825| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_17119| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 >SB_25825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +2 Query: 482 LRAYCRPWAFQLHQDRYLER-IFVRYIVFSSKILLLAICNS 601 LRAY +P+AF+ H+ + VR IV ++K L+L I S Sbjct: 36 LRAYPKPFAFKEHESHSAQTDNVVRCIVINNKSLILPIIRS 76 >SB_17119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 28.7 bits (61), Expect = 5.1 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -1 Query: 245 EVLCAKAIR*HVHFQCNMFSVKLKLFDR-IGITLDVFINGLAITSSSSEAL 96 E L +AIR + F C KLKL+D G++LD I L++ +SS L Sbjct: 146 EFLEQQAIRDKLTFSCVDDRSKLKLYDEGAGLSLDKTITILSMKEASSREL 196 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,097,395 Number of Sequences: 59808 Number of extensions: 382790 Number of successful extensions: 560 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 560 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -