BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40162 (658 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 36 0.018 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 36 0.018 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 36 0.024 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 35 0.041 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 35 0.041 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 35 0.055 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 33 0.13 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 33 0.13 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 31 0.89 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 31 0.89 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 31 0.89 At3g18480.1 68416.m02348 CCAAT displacement protein-related / CD... 30 1.6 At2g26700.1 68415.m03203 protein kinase family protein contains ... 29 2.1 At5g63720.1 68418.m07998 hypothetical protein 29 3.6 At5g18740.1 68418.m02224 expressed protein predicted proteins - ... 28 4.8 At4g38550.1 68417.m05458 expressed protein 24 5.4 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 27 8.3 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 36.3 bits (80), Expect = 0.018 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 184 CGHCKQLVPIYDKLGEHFENDDDVSLPK 267 CGHCK+L P Y+KLG F+ V + K Sbjct: 52 CGHCKKLAPEYEKLGASFKKAKSVLIAK 79 Score = 35.5 bits (78), Expect = 0.031 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +3 Query: 303 ITSFPTIKLYSKDNQV-HDYNGERTLAGLTKFV 398 ++ FPT+K + KDN+ HDY+G R L F+ Sbjct: 213 VSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFI 245 Score = 33.1 bits (72), Expect = 0.17 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 184 CGHCKQLVPIYDKLGEHFENDDDV 255 CGHCK L P Y+K+ F+ ++ V Sbjct: 171 CGHCKSLAPTYEKVATVFKQEEGV 194 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 36.3 bits (80), Expect = 0.018 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 184 CGHCKQLVPIYDKLGEHFENDDDVSLPK 267 CGHCK+L P Y+KLG F+ V + K Sbjct: 52 CGHCKKLAPEYEKLGASFKKAKSVLIAK 79 Score = 35.5 bits (78), Expect = 0.031 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +3 Query: 303 ITSFPTIKLYSKDNQV-HDYNGERTLAGLTKFV 398 ++ FPT+K + KDN+ HDY+G R L F+ Sbjct: 213 VSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFI 245 Score = 33.1 bits (72), Expect = 0.17 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 184 CGHCKQLVPIYDKLGEHFENDDDV 255 CGHCK L P Y+K+ F+ ++ V Sbjct: 171 CGHCKSLAPTYEKVATVFKQEEGV 194 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 35.9 bits (79), Expect = 0.024 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 184 CGHCKQLVPIYDKLGEHFENDDDVSLPK 267 CGHC++L PI D++ F+ND V + K Sbjct: 402 CGHCQKLAPILDEVALSFQNDPSVIIAK 429 Score = 31.9 bits (69), Expect = 0.39 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 6/66 (9%) Frame = +3 Query: 303 ITSFPTIKLYSKDNQVHDYNGERTLAGLTKFVETDGE------GAEPVPSVTEFEEEEDV 464 + FPTI S V Y G+RT FVE + E G E S E ++ E+ Sbjct: 444 VKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNSEKKPTSHGEESTKS-EEPKKTEET 502 Query: 465 PARDEL 482 A+DEL Sbjct: 503 AAKDEL 508 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 3/26 (11%) Frame = +1 Query: 154 QHEHFVL-FYR--CGHCKQLVPIYDK 222 +H+ V+ FY CGHC++L P Y+K Sbjct: 45 KHDFIVVEFYAPWCGHCQKLAPEYEK 70 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 35.1 bits (77), Expect = 0.041 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 184 CGHCKQLVPIYDKLGEHFENDDDVSLPK 267 CGHC+ L P+Y+KL +H + D + + K Sbjct: 471 CGHCQALEPMYNKLAKHLRSIDSLVITK 498 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 35.1 bits (77), Expect = 0.041 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 184 CGHCKQLVPIYDKLGEHFENDDDVSLPK 267 CGHC+ L P+Y+KL +H + D + + K Sbjct: 471 CGHCQALEPMYNKLAKHLRSIDSLVITK 498 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 34.7 bits (76), Expect = 0.055 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 184 CGHCKQLVPIYDKLGEHFENDDDVSLPK 267 CGHC+ PIY+KLG++ + D + + K Sbjct: 467 CGHCQSFEPIYNKLGKYLKGIDSLVVAK 494 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = +3 Query: 300 KITSFPTIKLYSKDNQVHDYNGERTLAGLTKFVETDGEGAEPVPSVTEFEEEEDV 464 +I FPT+ L+ Y GERT G+ +++ + + + ++T EE E V Sbjct: 167 EIQGFPTVFLFVDGEMRKTYEGERTKDGIVTWLKK--KASPSIHNITTKEEAERV 219 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 33.5 bits (73), Expect = 0.13 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 184 CGHCKQLVPIYDKLGEHFENDDDVSLPK 267 CGHC++L PI D++ +++D V + K Sbjct: 404 CGHCQKLAPILDEVAVSYQSDSSVVIAK 431 Score = 31.1 bits (67), Expect = 0.67 Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 3/26 (11%) Frame = +1 Query: 154 QHEHFVL-FYR--CGHCKQLVPIYDK 222 +H+ V+ FY CGHCKQL P Y+K Sbjct: 46 KHDFIVVEFYAPWCGHCKQLAPEYEK 71 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 33.5 bits (73), Expect = 0.13 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 184 CGHCKQLVPIYDKLGEHFENDDDVSLPK 267 CGHC++L PI D++ +++D V + K Sbjct: 404 CGHCQKLAPILDEVAVSYQSDSSVVIAK 431 Score = 31.1 bits (67), Expect = 0.67 Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 3/26 (11%) Frame = +1 Query: 154 QHEHFVL-FYR--CGHCKQLVPIYDK 222 +H+ V+ FY CGHCKQL P Y+K Sbjct: 46 KHDFIVVEFYAPWCGHCKQLAPEYEK 71 Score = 27.5 bits (58), Expect = 8.3 Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = +3 Query: 303 ITSFPTIKLYSKDNQVHDYNGERTLAGLTKFVETDGEG-AEPVPSVTEFEEEED 461 + FPTI S V Y G+RT FV+ + + EP EE +D Sbjct: 446 VKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDKNKDTVGEPKKEEETTEEVKD 499 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 30.7 bits (66), Expect = 0.89 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +1 Query: 184 CGHCKQLVPIYDKLGEHFENDDDVSL 261 C HCK+L +++ LG+ E DD++ + Sbjct: 55 CKHCKKLGNLWEDLGKAMEGDDEIEV 80 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 300 KITSFPTIKLYSKDNQVHDYNGERTLAGLTKFVETDGEGA 419 +I S+PT L+ +V Y G+R + L FV + E A Sbjct: 96 EIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEETEKA 135 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 30.7 bits (66), Expect = 0.89 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +1 Query: 184 CGHCKQLVPIYDKLGEHFENDDDVSL 261 C HCK+L +++ LG+ E DD++ + Sbjct: 55 CKHCKKLGNLWEDLGKAMEGDDEIEV 80 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 300 KITSFPTIKLYSKDNQVHDYNGERTLAGLTKFVETDGEGA 419 +I S+PT L+ +V Y G+R + L FV + E A Sbjct: 96 EIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEETEKA 135 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 30.7 bits (66), Expect = 0.89 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +1 Query: 184 CGHCKQLVPIYDKLGEHFENDDDVSL 261 C HCK+L +++ LG+ E DD++ + Sbjct: 55 CKHCKKLGNLWEDLGKAMEGDDEIEV 80 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 300 KITSFPTIKLYSKDNQVHDYNGERTLAGLTKFVETDGEGA 419 +I S+PT L+ +V Y G+R + L FV + E A Sbjct: 96 EIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEETEKA 135 >At3g18480.1 68416.m02348 CCAAT displacement protein-related / CDP-related similar to CCAAT displacement protein (CDP) (Cut-like 1) (Swiss-Prot:P39880) [Homo sapiens]; contains Pfam:PF00904 Involucrin repeat Length = 689 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +3 Query: 282 NELEHTKITSFPTIKLYSKDNQVHDYNGERTLA-GLTKFVE 401 +ELE TK + +KLY K V DYN ++ ++ G K+VE Sbjct: 544 DELEKTKADN---VKLYGKIRYVQDYNHDKVVSRGSKKYVE 581 >At2g26700.1 68415.m03203 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 525 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 166 FVLFYRCGHCKQLVPIYDKLGEHFENDDDVSLPKSTPPPTNWNTP 300 F L ++C Q + D+ H E+DDD+S+ + P+ TP Sbjct: 233 FDLSFKCDVVPQFLSDNDRDRGHQEDDDDISIRRKCSTPSCTTTP 277 >At5g63720.1 68418.m07998 hypothetical protein Length = 492 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 238 ENDDDVSLPKSTPPPTNWNTPRSRPSQRSN 327 +NDD VS ++PP T+ +T R QR N Sbjct: 323 QNDDSVSEVSTSPPHTDRDTSREPGKQRRN 352 >At5g18740.1 68418.m02224 expressed protein predicted proteins - Arabidopsis thaliana; expression supported by MPSS Length = 609 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 339 DNQVHDYNGERTLAGLTKFVETDGEGAEPVPSVTEFE 449 D+ D NG R T++ + EG+EP+ ++ + E Sbjct: 534 DDDDDDENGNRLFRACTEYTYNEAEGSEPIFTIPKSE 570 >At4g38550.1 68417.m05458 expressed protein Length = 612 Score = 23.8 bits (49), Expect(2) = 5.4 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +1 Query: 217 DKLGEHFENDDDVSLPKSTPP 279 +++ + +E DDDV+ S+PP Sbjct: 259 EQIEDFYEQDDDVTPRNSSPP 279 Score = 22.6 bits (46), Expect(2) = 5.4 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 268 STPPPTNWNTPRSRPSQRSN 327 S PPP + TP R S + N Sbjct: 289 SPPPPQPYRTPDHRRSHQDN 308 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 27.5 bits (58), Expect = 8.3 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = +1 Query: 184 CGHCKQLVPIYDKLGEHFEND 246 CG C+ ++PI +K+ ++N+ Sbjct: 239 CGPCRDMIPILNKMDSEYKNE 259 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,924,824 Number of Sequences: 28952 Number of extensions: 220547 Number of successful extensions: 760 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 760 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1373722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -