Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV40161
         (650 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF349467-1|AAL83913.1| 1023|Homo sapiens amplified in breast can...    30   6.2  

>AF349467-1|AAL83913.1| 1023|Homo sapiens amplified in breast cancer
           2 protein.
          Length = 1023

 Score = 30.3 bits (65), Expect = 6.2
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = -1

Query: 515 KASPEARHQSYPNL-NNLQIPVCIRSRNHPHRTHSRNARFPSNHHRQDQIH-SLLRYYFS 342
           KA P A      NL +N  +PV         R +S++AR P+ H    Q+H    +++ +
Sbjct: 502 KALPMAHSAYQSNLPHNYPMPVHKNQLAQARRVYSQHARGPAFHKYAMQLHEDCYKFWSN 561

Query: 341 EHSIC 327
            H +C
Sbjct: 562 GHQLC 566


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 93,324,915
Number of Sequences: 237096
Number of extensions: 1992086
Number of successful extensions: 4111
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3875
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4108
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7253890590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)