BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40160 (665 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15870| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 9e-22 SB_54666| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_28512| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 SB_53794| Best HMM Match : Mito_carr (HMM E-Value=0.00014) 52 4e-07 SB_18218| Best HMM Match : Mito_carr (HMM E-Value=0) 45 6e-05 SB_11756| Best HMM Match : Mito_carr (HMM E-Value=0) 42 5e-04 SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) 41 8e-04 SB_1246| Best HMM Match : Mito_carr (HMM E-Value=1.4013e-45) 40 0.002 SB_49149| Best HMM Match : Mito_carr (HMM E-Value=4.7e-22) 39 0.003 SB_4905| Best HMM Match : Mito_carr (HMM E-Value=3.3e-13) 38 0.010 SB_46794| Best HMM Match : Mito_carr (HMM E-Value=1.12104e-44) 37 0.017 SB_36589| Best HMM Match : Mito_carr (HMM E-Value=0) 36 0.022 SB_42958| Best HMM Match : Mito_carr (HMM E-Value=4.60046e-42) 36 0.030 SB_23056| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_31912| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.052 SB_47003| Best HMM Match : Mito_carr (HMM E-Value=2.3e-29) 35 0.068 SB_45843| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) 33 0.21 SB_17535| Best HMM Match : C2 (HMM E-Value=2.7e-14) 33 0.28 SB_8951| Best HMM Match : Mito_carr (HMM E-Value=0) 33 0.28 SB_3139| Best HMM Match : Mito_carr (HMM E-Value=0) 33 0.28 SB_34206| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_54004| Best HMM Match : Mito_carr (HMM E-Value=0) 32 0.48 SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) 31 0.64 SB_3432| Best HMM Match : 7tm_1 (HMM E-Value=3.8e-28) 31 0.64 SB_189| Best HMM Match : Peptidase_A17 (HMM E-Value=1.9e-35) 31 0.64 SB_51010| Best HMM Match : Mito_carr (HMM E-Value=0) 31 0.84 SB_24124| Best HMM Match : DUF1213 (HMM E-Value=3.9) 31 0.84 SB_52834| Best HMM Match : Mito_carr (HMM E-Value=6.7e-34) 31 0.84 SB_46795| Best HMM Match : Mito_carr (HMM E-Value=0) 31 1.1 SB_5442| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_5019| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_19664| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_23920| Best HMM Match : Mito_carr (HMM E-Value=0.00039) 30 1.9 SB_43597| Best HMM Match : TP2 (HMM E-Value=1.7) 29 2.6 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_39097| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_37560| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_32924| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_12356| Best HMM Match : zf-CCHC (HMM E-Value=0.018) 29 4.5 SB_11434| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_31675| Best HMM Match : zf-CCHC (HMM E-Value=0.012) 28 5.9 SB_45532| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-40) 28 5.9 SB_16884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_28925| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 28 7.9 >SB_15870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 100 bits (240), Expect = 9e-22 Identities = 49/80 (61%), Positives = 58/80 (72%), Gaps = 1/80 (1%) Frame = +1 Query: 256 VSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVI 432 +SKTA APIERVKLL+Q Q + K D YKG++D R + +G LSFWRGN AN I Sbjct: 22 ISKTAAAPIERVKLLVQNQDEMLKAGRLDHPYKGVIDCTSRTYRSEGFLSFWRGNLANCI 81 Query: 433 RYFPTQALNFAFKDKYKQVF 492 RYFPTQALNFAFKD+ K +F Sbjct: 82 RYFPTQALNFAFKDQVKALF 101 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/33 (60%), Positives = 25/33 (75%), Gaps = 2/33 (6%) Frame = +3 Query: 573 SLCFVYPLDFARTRLAAD--VGKGDGQREFSGL 665 SL FVY LD+ RTRLA D VGK G+R+F+G+ Sbjct: 127 SLFFVYSLDYCRTRLANDAKVGKKGGERQFNGM 159 Score = 36.7 bits (81), Expect = 0.017 Identities = 16/51 (31%), Positives = 32/51 (62%) Frame = +1 Query: 343 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 495 +YKG +D ++I K++G +S +G AN++R + F DK+K++++ Sbjct: 248 KYKGSIDCTIQILKKEGAMSLMKGAGANILRGMAGAGVLAGF-DKFKELYV 297 >SB_54666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 72.5 bits (170), Expect = 3e-13 Identities = 33/77 (42%), Positives = 55/77 (71%) Frame = +1 Query: 256 VSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 435 VS+T+V+P+ERVK+LLQ+Q + ++KG++ ++I KE+G+L +++GN NVIR Sbjct: 47 VSRTSVSPLERVKILLQIQ------VKNPKFKGVLPTLIQIGKEEGILGYFKGNGTNVIR 100 Query: 436 YFPTQALNFAFKDKYKQ 486 FP A+ FA ++YK+ Sbjct: 101 IFPYSAVQFAAYEEYKK 117 >SB_28512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 453 Score = 60.9 bits (141), Expect = 9e-10 Identities = 40/99 (40%), Positives = 57/99 (57%) Frame = +1 Query: 247 LRRVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFAN 426 L VS+TA AP++R+K+LLQVQ A+ GIV F + +E G+ S WRGN AN Sbjct: 146 LAGVSRTATAPLDRLKVLLQVQ------ASSTNRFGIVSGFKMMLREGGIKSLWRGNGAN 199 Query: 427 VIRYFPTQALNFAFKDKYKQVFLGGVDRRRSSGVTSLVI 543 VI+ P + F +K K+ L G D ++ GVT ++ Sbjct: 200 VIKIAPESGIKFFAYEKAKK--LVGSD-TKALGVTDRLL 235 Score = 36.3 bits (80), Expect = 0.022 Identities = 20/79 (25%), Positives = 43/79 (54%) Frame = +1 Query: 259 SKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRY 438 S+T++ P+E +K L ++ + Y+G++ A I +++G+ SF+RG F +++ Sbjct: 244 SQTSIYPLEVLKTRLAIRKTGQ-------YRGLLHAASVIYQKEGIRSFYRGLFPSLLGI 296 Query: 439 FPTQALNFAFKDKYKQVFL 495 P ++ A + K +L Sbjct: 297 IPYAGIDLAVYETLKNFYL 315 >SB_53794| Best HMM Match : Mito_carr (HMM E-Value=0.00014) Length = 76 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/53 (50%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = +1 Query: 256 VSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWR 411 +SKTA APIERVKLL+Q Q + K YKG+VD +R + +G+ SFWR Sbjct: 23 ISKTAAAPIERVKLLVQNQDEMLKAGRLSSPYKGVVDCTMRTYRAEGIGSFWR 75 >SB_18218| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 375 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/55 (32%), Positives = 31/55 (56%) Frame = +1 Query: 301 LQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFA 465 L+V V Q+ + G++ F + K +G+ +FW+GN + IR FP A+ +A Sbjct: 79 LEVVKVLAQVGTQEAKPGLIRTFASVYKREGIKAFWKGNGVSCIRLFPYSAVQYA 133 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/63 (34%), Positives = 35/63 (55%) Frame = +1 Query: 256 VSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 435 ++ V P E +K L VQHV+K A YKG+ A I +E+G+L+ ++G + + Sbjct: 165 IAMVTVYPCEVIKTRLTVQHVNKSNA---HYKGMRHALKTILREEGILALYKGVTPSFLG 221 Query: 436 YFP 444 FP Sbjct: 222 LFP 224 >SB_11756| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 274 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/64 (32%), Positives = 38/64 (59%) Frame = +1 Query: 271 VAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQ 450 +AP++ VK+ LQ+Q +K+ + Y+G VD V++ + +GL ++GN +R P Sbjct: 51 IAPVDLVKIKLQMQTEAKR-STRSVYRGPVDCLVKLYRSRGLAGCFQGNTVTAVRDIPGF 109 Query: 451 ALNF 462 A+ F Sbjct: 110 AVYF 113 Score = 33.1 bits (72), Expect = 0.21 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +1 Query: 343 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 462 RYKG++D ++ KE+G++ F RG + ++R F Q L F Sbjct: 170 RYKGMMDCALQSYKEEGMIVFTRGIWPTLLRGF-LQVLRF 208 >SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) Length = 1026 Score = 41.1 bits (92), Expect = 8e-04 Identities = 21/76 (27%), Positives = 39/76 (51%) Frame = +1 Query: 265 TAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 444 TAV PI+ VK +Q Q + A++ YK +D F ++ + +G + +RG ++ P Sbjct: 929 TAVYPIDLVKTRMQNQRAV--LEAEKVYKNSIDCFFKVVRNEGPIGLYRGLLPQLLGVSP 986 Query: 445 TQALNFAFKDKYKQVF 492 +A+ D + +F Sbjct: 987 EKAIKLTTNDFVRGIF 1002 >SB_1246| Best HMM Match : Mito_carr (HMM E-Value=1.4013e-45) Length = 773 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/48 (29%), Positives = 30/48 (62%) Frame = +1 Query: 343 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 486 +Y G+ +I +++GL +++GN N++R P A+ FA +++K+ Sbjct: 590 KYSGVGGTLAKIYRDEGLYGYFKGNGTNIVRIVPYTAVQFAAYEEFKK 637 >SB_49149| Best HMM Match : Mito_carr (HMM E-Value=4.7e-22) Length = 95 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/55 (29%), Positives = 32/55 (58%) Frame = +1 Query: 328 IAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 492 I ++Y G+++AF RI +++G+ +F+RG +I P ++F + K+ F Sbjct: 19 ITQKKKYTGLINAFTRIYRDEGMRTFYRGYVPTLIGIMPYAGISFFTYETCKKAF 73 >SB_4905| Best HMM Match : Mito_carr (HMM E-Value=3.3e-13) Length = 577 Score = 37.5 bits (83), Expect = 0.010 Identities = 20/53 (37%), Positives = 31/53 (58%) Frame = +1 Query: 256 VSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 414 ++ V P E +K L VQHV+K A YKG+ A I +E+G+L+ ++G Sbjct: 434 IAMVTVYPCEVIKTRLTVQHVNKSNA---HYKGMRHALKTILREEGILALYKG 483 >SB_46794| Best HMM Match : Mito_carr (HMM E-Value=1.12104e-44) Length = 192 Score = 36.7 bits (81), Expect = 0.017 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = +1 Query: 346 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 495 Y + +A R+ KE+G+L+ WRG +R A A + KQ+ L Sbjct: 35 YTNVFNALYRMSKEEGVLTLWRGYIPTAVRAMVVNAAQLATYSQAKQLLL 84 Score = 36.3 bits (80), Expect = 0.022 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 3/81 (3%) Frame = +1 Query: 268 AVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPT 447 A P++ K +Q + I YKG +D RI + +G+ + W+G R P Sbjct: 110 ASMPVDIAKTRIQNMRI---IDGKPEYKGTMDVLARIVRNEGVFALWKGFTPYYFRIGPH 166 Query: 448 QALNFAFKDKYKQV---FLGG 501 L F F ++ + F GG Sbjct: 167 TVLTFIFLEQLNRAANYFYGG 187 >SB_36589| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 264 Score = 36.3 bits (80), Expect = 0.022 Identities = 16/45 (35%), Positives = 29/45 (64%) Frame = +1 Query: 355 IVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 489 ++ AF I + +GLL++++GN A ++R FP A+ F + Y +V Sbjct: 13 VLTAFRAIYRNEGLLAYFKGNGAMMLRTFPYGAVQFLSYEHYSKV 57 >SB_42958| Best HMM Match : Mito_carr (HMM E-Value=4.60046e-42) Length = 247 Score = 35.9 bits (79), Expect = 0.030 Identities = 19/47 (40%), Positives = 28/47 (59%) Frame = +1 Query: 274 APIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 414 AP ERVK LLQVQ K+ RY+G+ D +++ + GL ++G Sbjct: 179 APTERVKCLLQVQ---KESGTKARYQGLGDCLLQVYRTGGLRGVFKG 222 >SB_23056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 35.5 bits (78), Expect = 0.039 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +1 Query: 358 VDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYK 483 +DA ++IP+ +GL S WRG ++ P + F D+ K Sbjct: 64 IDALIKIPRYEGLSSLWRGLPPTMVMAVPNTVIYFTLYDQLK 105 >SB_31912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 35.1 bits (77), Expect = 0.052 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +1 Query: 256 VSKTAVAPIERVKLLLQVQ---HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 414 +SK + P + +K +QVQ + Q+Y G+ D F I KE+G + ++G Sbjct: 42 ISKAVILPFDIIKKRIQVQGFEEARQSFGRVQQYDGVKDCFRTILKEEGAMGLFKG 97 >SB_47003| Best HMM Match : Mito_carr (HMM E-Value=2.3e-29) Length = 868 Score = 34.7 bits (76), Expect = 0.068 Identities = 19/71 (26%), Positives = 33/71 (46%) Frame = +1 Query: 277 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 456 PI+ K +QVQ + Q A +Y+ + A I + G+ ++G A ++R P Sbjct: 221 PIDLFKSKMQVQIIRAQSGAPIQYRNVFHAGYTIAQTYGIRGCYQGLSATLVRNIPANGF 280 Query: 457 NFAFKDKYKQV 489 F F + K + Sbjct: 281 FFGFYEFTKNL 291 >SB_45843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = +1 Query: 376 IPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 489 +P+E L W G F++VI F A+N AF+++YK++ Sbjct: 272 LPREVYLFYSWIGAFSSVINPFIYGAMNPAFREEYKKI 309 >SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 611 Score = 33.1 bits (72), Expect = 0.21 Identities = 17/59 (28%), Positives = 27/59 (45%) Frame = +1 Query: 277 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQA 453 P++ VK Q + +Y G D +I G+ +F +G A ++R FPT A Sbjct: 377 PVDMVKSCYQADGRTNSGKPQYKYNGYADCVKKIYISGGVSAFGQGLLATILRGFPTNA 435 >SB_17535| Best HMM Match : C2 (HMM E-Value=2.7e-14) Length = 553 Score = 32.7 bits (71), Expect = 0.28 Identities = 19/56 (33%), Positives = 31/56 (55%) Frame = +1 Query: 250 RRVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGN 417 +R S+ VA ER +L+ Q Q +D RY+G +D+F + +G L +RG+ Sbjct: 275 KRQSRQTVACPERCGVLMASQGKRGQYMSDARYRGHLDSFRGDARYRGHLDSFRGD 330 >SB_8951| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 434 Score = 32.7 bits (71), Expect = 0.28 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 5/76 (6%) Frame = +1 Query: 232 PGWRYLRRVSKTAVA-----PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 396 P WR++ + VA P++ V+ L VQ +S + ++ Y GIV A RI E+G+ Sbjct: 28 PLWRFVSGATAGVVATASTHPLDVVRARLTVQDMSTRSISN--YTGIVSALRRIHIEEGI 85 Query: 397 LSFWRGNFANVIRYFP 444 ++G +++ P Sbjct: 86 RGLYKGLVPSLVSIAP 101 >SB_3139| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 276 Score = 32.7 bits (71), Expect = 0.28 Identities = 19/88 (21%), Positives = 42/88 (47%), Gaps = 9/88 (10%) Frame = +1 Query: 256 VSKTAVAPIERVKLLLQVQHVSKQIAA---------DQRYKGIVDAFVRIPKEQGLLSFW 408 +++ A PI+ K+ LQ+Q S +A+ D Y+G++ V + K +G+ + + Sbjct: 27 IAEAATIPIDTAKVRLQIQGESAVMASIAQGVRTTHDAHYRGMLGTMVTLFKTEGMKTMY 86 Query: 409 RGNFANVIRYFPTQALNFAFKDKYKQVF 492 +G + R ++ D+ K ++ Sbjct: 87 KGLIPGIHRQLCFASIRIGLYDQVKAMY 114 >SB_34206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 32.3 bits (70), Expect = 0.37 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 376 IPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 489 +P+E +L W G ++VI F A+N F+D+YK++ Sbjct: 139 LPREVYVLYTWLGTLSSVINPFIYGAMNPVFRDEYKKL 176 >SB_54004| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 309 Score = 31.9 bits (69), Expect = 0.48 Identities = 16/62 (25%), Positives = 33/62 (53%) Frame = +1 Query: 277 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 456 P++ +K+ LQ + K +KG +D F++ + +GL ++G + ++ P+ AL Sbjct: 40 PLDLLKVRLQAMNQVKP-GETAPFKGAMDCFMKTVRLEGLRGLYKGMLSPLLMATPSTAL 98 Query: 457 NF 462 F Sbjct: 99 TF 100 >SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 203 Score = 31.5 bits (68), Expect = 0.64 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 2/82 (2%) Frame = +1 Query: 268 AVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPT 447 A+ PIE +K LQ+ Y+G++ + KE+G+ +F+R + P Sbjct: 14 AMNPIEVIKQRLQMY--------GSPYRGVIHCATSVFKEEGIRAFYRSYTTQLSMNIPF 65 Query: 448 QALNFAFKDKYKQVF--LGGVD 507 Q L+F + ++ LGG D Sbjct: 66 QTLHFTVYEYARKALNPLGGYD 87 >SB_3432| Best HMM Match : 7tm_1 (HMM E-Value=3.8e-28) Length = 343 Score = 31.5 bits (68), Expect = 0.64 Identities = 18/51 (35%), Positives = 29/51 (56%) Frame = +1 Query: 376 IPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDRRRSSGV 528 +P+E L + G ++VI F A+N F+++YK+VF R R+S V Sbjct: 263 LPRELYFLYTYVGVLSSVINPFIYGAMNPMFREEYKKVFRIATFRGRNSAV 313 >SB_189| Best HMM Match : Peptidase_A17 (HMM E-Value=1.9e-35) Length = 965 Score = 31.5 bits (68), Expect = 0.64 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = -3 Query: 252 AEIPPARKSLANATGSARFDILFDYVIFTR*ICRGGSCGTRGWGI 118 A++PP R +A + + FD+ + I TR RGG ++ WG+ Sbjct: 538 ADLPPDRTEVAPSFTNVGFDVFGPWTIHTR-KTRGGVLNSKRWGL 581 >SB_51010| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 306 Score = 31.1 bits (67), Expect = 0.84 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = +1 Query: 256 VSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 414 + P + VK+ Q + + I YK + AF +I K++G L W G Sbjct: 127 IGSAIATPTDLVKIRFQAVKIGETIP----YKNMFHAFYKIAKKEGFLGLWTG 175 >SB_24124| Best HMM Match : DUF1213 (HMM E-Value=3.9) Length = 283 Score = 31.1 bits (67), Expect = 0.84 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +3 Query: 246 SPPRLQDRRSTNRACQAAAPSTARQQADRRRPALQGYRRRLRPHPQGAGSP 398 S P+ QD++ST++ QA +P ++QQA R+ Q ++ P +P Sbjct: 124 SKPQDQDKQSTDQDKQATSPKISKQQAPRQASNKQQDKQATSPKTSKQQAP 174 >SB_52834| Best HMM Match : Mito_carr (HMM E-Value=6.7e-34) Length = 302 Score = 31.1 bits (67), Expect = 0.84 Identities = 17/62 (27%), Positives = 32/62 (51%) Frame = +1 Query: 259 SKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRY 438 + AV P++ +K LQ+ + + + Y GI+D +I +GL +F++G +I Sbjct: 219 ASVAVNPLDVIKTRLQLLNRPQ---GEPNYNGIIDCAKKIYSNEGLAAFYKGAVPRMIVI 275 Query: 439 FP 444 P Sbjct: 276 AP 277 >SB_46795| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 328 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/58 (29%), Positives = 29/58 (50%) Frame = +1 Query: 271 VAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 444 + P++RVK +LQ++ + Y G VD RI +E G+ ++G +R P Sbjct: 155 LTPLDRVKCILQIE----KAFGGSSYGGPVDCLRRIYREAGVRGVYKGISVTAMRDIP 208 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/63 (23%), Positives = 29/63 (46%) Frame = +1 Query: 277 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 456 P++ +K+ LQ + K YK D F +I + +G+ +RG ++ P + Sbjct: 58 PLDTIKVRLQAMPLPKP-GEPWMYKNSFDCFFKIIRNEGVYYLFRGVTVPILNSIPNTTV 116 Query: 457 NFA 465 F+ Sbjct: 117 LFS 119 >SB_5442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 30.7 bits (66), Expect = 1.1 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +1 Query: 271 VAPIERVKLLLQVQHVSKQIAADQRYK-GIVDAFVRIPKEQGLLSFWRGNFANVIRYFP 444 + P E +K LQ QH + I+ K G++D ++I + G +RG A R P Sbjct: 124 LCPAELIKCRLQAQHQTNLISGMAGPKSGVIDVTMQIIRNDGFQGLFRGMTATWAREVP 182 >SB_5019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1616 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -3 Query: 252 AEIPPARKSLANATGSARFDILFDYVIFTR*ICRGGSCGTRGWGI 118 A++PP R +A + FD+ + I TR RGG ++ WG+ Sbjct: 1265 ADLPPDRTEVAPPFTNVGFDVFGPWTIHTR-KTRGGVLNSKRWGL 1308 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 30.3 bits (65), Expect = 1.5 Identities = 35/125 (28%), Positives = 56/125 (44%), Gaps = 2/125 (1%) Frame = +3 Query: 3 ALERDRSNFKKGTHLPSVLP*LRNYSKSPVQKSGVSVS*SPIRVCRNSHLDIFT**RSHN 182 A++R + + + + S P + +K S S SP RV ++S R + Sbjct: 994 AVKRTKGSKRSESRSVSRSPERDRKGRDSAKKERQSHSESPQRVTKSSKERPRKRPRHQS 1053 Query: 183 RTKCRTS--PIRSRSLRTSWLAVSPPRLQDRRSTNRACQAAAPSTARQQADRRRPALQGY 356 R + +S P RSR RTS SP R + R +R + +PS +++ RR P+ Sbjct: 1054 RERRPSSSPPRRSRPQRTS---PSPRRTPEDRRRSRGSR-RSPSPPKREPRRRSPSASPP 1109 Query: 357 RRRLR 371 RR R Sbjct: 1110 RREAR 1114 >SB_19664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 632 Score = 29.9 bits (64), Expect = 1.9 Identities = 23/61 (37%), Positives = 29/61 (47%) Frame = +3 Query: 183 RTKCRTSPIRSRSLRTSWLAVSPPRLQDRRSTNRACQAAAPSTARQQADRRRPALQGYRR 362 RT+ R + R R + V+ R DRR T A T+R+Q DRRR Q RR Sbjct: 85 RTRARVTSRRQVDRRRTRARVTIRRQVDRRRTR------ARVTSRRQVDRRRTRAQVTRR 138 Query: 363 R 365 R Sbjct: 139 R 139 Score = 27.9 bits (59), Expect = 7.9 Identities = 22/61 (36%), Positives = 28/61 (45%) Frame = +3 Query: 183 RTKCRTSPIRSRSLRTSWLAVSPPRLQDRRSTNRACQAAAPSTARQQADRRRPALQGYRR 362 RT+ R + R R + V+ R DRR T A T R+Q DRRR + RR Sbjct: 100 RTRARVTIRRQVDRRRTRARVTSRRQVDRRRTR------AQVTRRRQVDRRRTRARVTRR 153 Query: 363 R 365 R Sbjct: 154 R 154 >SB_23920| Best HMM Match : Mito_carr (HMM E-Value=0.00039) Length = 54 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +1 Query: 352 GIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 489 G+V + G +RGN A ++R P ++ F ++YK++ Sbjct: 1 GVVHVLTQTYTTNGFTGLFRGNSATMMRVVPYASIQFTSHEQYKKL 46 >SB_43597| Best HMM Match : TP2 (HMM E-Value=1.7) Length = 272 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -2 Query: 664 RPENSRWPSPLPTSAARRVRAKSRGYTK 581 RP +SR S P+SA+RR ++SRG + Sbjct: 221 RPSSSRPSSARPSSASRRASSRSRGLAR 248 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = -3 Query: 627 HRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASS 508 + RD RS+ +R++ RWL R R+P S+ R++S+ Sbjct: 6 NNNRDN-TRSQVRSRNSNRWLLRQQRQPQRHLSHKRSSSN 44 >SB_39097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 297 AAPSTARQQADRRRPALQGYRRR-LRPHPQGAGSP 398 A+ S RQQ R RP +GY +R R +P+ SP Sbjct: 83 ASGSNQRQQQARGRPQARGYNQRSRRGYPRARASP 117 >SB_37560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 706 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 297 AAPSTARQQADRRRPALQGYRRR-LRPHPQGAGSP 398 A+ S RQQ R RP +GY +R R +P+ SP Sbjct: 183 ASGSNQRQQQARGRPQARGYNQRSRRGYPRARASP 217 >SB_32924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 395 Score = 28.7 bits (61), Expect = 4.5 Identities = 19/47 (40%), Positives = 26/47 (55%) Frame = +1 Query: 133 CAATPTSTYSPSEDHIIEQNVEPRRSGRVR*GLPGWRYLRRVSKTAV 273 CA +T +PS ++ N+E R+ R L GWR LRR+ KT V Sbjct: 268 CALVLHTTINPSVHFVL--NLEFRQELRDM-CLTGWRALRRMKKTVV 311 >SB_12356| Best HMM Match : zf-CCHC (HMM E-Value=0.018) Length = 404 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 297 AAPSTARQQADRRRPALQGYRRR-LRPHPQGAGSP 398 A+ S RQQ R RP +GY +R R +P+ SP Sbjct: 261 ASGSNQRQQQARGRPQARGYNQRSRRGYPRARASP 295 >SB_11434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 866 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +1 Query: 379 PKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 495 P+E L W G ++VI F +N F++++K+++L Sbjct: 815 PRELYLFYSWLGALSSVINPFIYGVMNPMFREEFKRIYL 853 >SB_31675| Best HMM Match : zf-CCHC (HMM E-Value=0.012) Length = 550 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +3 Query: 297 AAPSTARQQADRRRPALQGYRRR-LRPHPQGAGSP 398 A+ S RQQ R RP GY +R R +P+ SP Sbjct: 84 ASGSNQRQQQARGRPQASGYNQRSRRGYPRARASP 118 >SB_45532| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-40) Length = 368 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +1 Query: 376 IPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 489 +P+E +L + G ++VI F A+N FK++YK++ Sbjct: 267 LPREVYVLYSFLGGLSSVINPFIYGAMNPIFKEQYKKI 304 >SB_16884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 27.9 bits (59), Expect = 7.9 Identities = 19/63 (30%), Positives = 30/63 (47%) Frame = +1 Query: 277 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 456 P E VK LQ+ + AA Y+G +D + K G+L +RG + + P ++ Sbjct: 60 PTEYVKTQLQLD----EKAAKPIYRGPIDCVKKTVKGHGVLGLYRGLSSLLYGSVPKASV 115 Query: 457 NFA 465 FA Sbjct: 116 RFA 118 >SB_28925| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 792 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Frame = +1 Query: 25 ISKKAHTYPLCSRDYEITPNLLFKNQELV----FRDPPSACAATPTSTYSPS 168 ++ ++ Y C + E +P + + ++D SAC A P TY PS Sbjct: 106 LTDESELYGYCQSNGEWSPAMYTSRHRCMCHAGYQDTVSACTACPRGTYKPS 157 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,823,617 Number of Sequences: 59808 Number of extensions: 453179 Number of successful extensions: 1571 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 1392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1563 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -