BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40158 (501 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34773| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_23054| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 32 0.23 SB_39560| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00055) 32 0.23 SB_23934| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) 32 0.23 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_39497| Best HMM Match : zf-C3HC4 (HMM E-Value=5.1e-12) 31 0.40 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 31 0.40 SB_698| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00037) 31 0.53 SB_49946| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.93 SB_32416| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0021) 30 1.2 SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 29 2.2 SB_45313| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_38572| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0034) 28 5.0 SB_15794| Best HMM Match : DUF1605 (HMM E-Value=5.9e-12) 27 6.6 SB_54717| Best HMM Match : Aldo_ket_red (HMM E-Value=0) 27 6.6 SB_55478| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_40933| Best HMM Match : DUF548 (HMM E-Value=1.7) 27 8.7 SB_17212| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_27518| Best HMM Match : RWD (HMM E-Value=0.015) 27 8.7 >SB_34773| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 54.8 bits (126), Expect = 4e-08 Identities = 19/35 (54%), Positives = 26/35 (74%) Frame = +2 Query: 107 KGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIM 211 K +K F +KKWNA+A+W+WD+ D CAICR +M Sbjct: 25 KESQKMFSLKKWNAIAMWSWDVECDTCAICRVQVM 59 >SB_23054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 38.7 bits (86), Expect = 0.003 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 283 CNHAFHFHCISRWLKTRQVCPLDNR 357 C H FH CI WL T+ +CP+D + Sbjct: 230 CRHVFHRDCIDSWLATQSICPVDGQ 254 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 32.3 bits (70), Expect = 0.23 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 283 CNHAFHFHCISRWLKTRQVCPL 348 C+H+F +C+ WL+ R CP+ Sbjct: 386 CSHSFCEYCLQSWLRKRNTCPI 407 >SB_39560| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00055) Length = 545 Score = 32.3 bits (70), Expect = 0.23 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +1 Query: 283 CNHAFHFHCISRWLK 327 CNH FH CI RWLK Sbjct: 379 CNHDFHSKCIDRWLK 393 >SB_23934| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) Length = 617 Score = 32.3 bits (70), Expect = 0.23 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 262 CTVAWGVCNHAFHFHCISRWLKTRQVCP 345 CT+ C H+FH HCI WL P Sbjct: 571 CTLLGLPCGHSFHQHCIEVWLAGDNTAP 598 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 31.9 bits (69), Expect = 0.31 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 283 CNHAFHFHCISRWL-KTRQVCPLDNREWEFQK 375 C+HA+H C+ WL + ++ CP+ R E K Sbjct: 319 CDHAYHCKCVDPWLTEGKRTCPVCKRPVETSK 350 >SB_39497| Best HMM Match : zf-C3HC4 (HMM E-Value=5.1e-12) Length = 558 Score = 31.5 bits (68), Expect = 0.40 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 283 CNHAFHFHCISRWLKTRQVCPL 348 C H FH C+ WL + CPL Sbjct: 232 CRHEFHKECVDPWLLSNFTCPL 253 >SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) Length = 398 Score = 31.5 bits (68), Expect = 0.40 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 280 VCNHAFHFHCISRWLKTRQVCPL 348 VC H + C+SRWL+ CP+ Sbjct: 279 VCGHKYCEPCLSRWLENNTTCPI 301 >SB_698| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00037) Length = 303 Score = 31.1 bits (67), Expect = 0.53 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 283 CNHAFHFHCISRWLK-TRQVCPLDNRE 360 C H FH CI WL T CPLD E Sbjct: 275 CRHNFHSACIRTWLTYTSCKCPLDGLE 301 >SB_49946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 30.3 bits (65), Expect = 0.93 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 Query: 283 CNHAFHFHCISRWLKTRQVCPLDNRE 360 C+H FH CI WL+ CP+ E Sbjct: 80 CDHLFHPGCILPWLEKTNSCPVCRHE 105 >SB_32416| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0021) Length = 358 Score = 29.9 bits (64), Expect = 1.2 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 283 CNHAFHFHCISRWLKTRQVCPLDNREWEFQ 372 C H +H CI +WLK R D +W+ + Sbjct: 311 CLHEYHTRCIDKWLKNR-----DQSQWKLE 335 >SB_39478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = +1 Query: 280 VCNHAFHFHCISRWLKT---RQVCPL 348 +C H F + C+ RWL+T R +CP+ Sbjct: 77 MCGHLFCWPCLHRWLETRPNRSMCPV 102 >SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 29.1 bits (62), Expect = 2.2 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = +2 Query: 107 KGDKKRFEVKKWNAVALW-AWDIVVDNCAICRNHIMDLCIECQANQASATMKNAQLLGVF 283 K K FE KK NA AL ++ V I RN ++C C+A + S+ ++ L Sbjct: 162 KEGKLHFEAKKRNAPALPPVRELKVLKDNISRNSSSEICPSCRALETSSLIEFFSLSAKT 221 Query: 284 VIMHSISTV 310 ++ ++T+ Sbjct: 222 IVSSCLATL 230 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 29.1 bits (62), Expect = 2.2 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 283 CNHAFHFHCISRWLKTRQVCPL 348 C H F CIS W Q CP+ Sbjct: 499 CKHIFCEDCISLWFDREQTCPM 520 >SB_45313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 28.7 bits (61), Expect = 2.8 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 226 MPSKSSLSHYEECTVAWGVCNHAFHFHCISR 318 +P S + YE+ T+AW C++ C+SR Sbjct: 37 VPRNSRIPSYEQATIAWATCDYI--CVCVSR 65 >SB_38572| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0034) Length = 671 Score = 27.9 bits (59), Expect = 5.0 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +1 Query: 220 YRMPSKSSLSHYEECTVAWGVC--NHAFHFHCISRWLKTRQVCP 345 ++ P+KS++ E+ VC H F C+ WL+T + CP Sbjct: 96 HQCPTKSAILDLEKVKEPV-VCPNQHVFCSPCLDLWLRTNRYCP 138 >SB_15794| Best HMM Match : DUF1605 (HMM E-Value=5.9e-12) Length = 655 Score = 27.5 bits (58), Expect = 6.6 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -3 Query: 436 SEDVKLLCRMQLF*MTFNDHTFGTPILYCLVDKLVESSTNG 314 SE+ K L + ++ TF+D ++YCL+D + S G Sbjct: 22 SEETKEL--LAVYHKTFDDDRVDLDLIYCLIDHICNSGQQG 60 >SB_54717| Best HMM Match : Aldo_ket_red (HMM E-Value=0) Length = 333 Score = 27.5 bits (58), Expect = 6.6 Identities = 24/61 (39%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = -3 Query: 304 GNGMHDYKHPKQ--LCILHSG*GLICLAFDTQIHYVISANSTVVDNNIPSPECYCIPLFY 131 G G HD H KQ L L SG LI A ++ H S V +NIP E Y + Y Sbjct: 80 GLGAHDI-HSKQAVLWALESGYRLIDTA--SRYHNEQSVGEAVRCSNIPRCEIYVVTKVY 136 Query: 130 F 128 F Sbjct: 137 F 137 >SB_55478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.1 bits (57), Expect = 8.7 Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = -1 Query: 252 VAEA*FAWHSIHRSIM*FRQIAQLSTTISQAQSA-TAFHFFTSNLFLSPLP 103 V A ++ +H +++ ++I +T I ++ F+F TS+L +SPLP Sbjct: 48 VPSAPHSFGEVHTAVVGHQKIKPKNTLIHDIRNLHLVFYFRTSDLHVSPLP 98 >SB_40933| Best HMM Match : DUF548 (HMM E-Value=1.7) Length = 682 Score = 27.1 bits (57), Expect = 8.7 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 182 NCAICRNHIMDLCIECQANQASATMKNAQLL 274 NC+I RN ++C C+A + S + A LL Sbjct: 89 NCSISRNSSSEICPSCRALETSLSSCLATLL 119 >SB_17212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 27.1 bits (57), Expect = 8.7 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = +2 Query: 191 ICRNHIMDLCIECQANQASATMKNAQLLGVFVIMHSISTVFP 316 ICRN ++C C+A S+ ++ L ++ ++T+ P Sbjct: 149 ICRNSSSEICPSCRALDTSSLIEFFLLSAKTIVSSCLATLLP 190 >SB_27518| Best HMM Match : RWD (HMM E-Value=0.015) Length = 277 Score = 27.1 bits (57), Expect = 8.7 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +1 Query: 283 CNHAFHFHCISRWLKT 330 C H FH+ C+ +++KT Sbjct: 254 CAHVFHYGCLDKYMKT 269 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,877,506 Number of Sequences: 59808 Number of extensions: 350267 Number of successful extensions: 738 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 737 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -