BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40154 (749 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) 48 8e-06 SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) 45 8e-05 SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) 38 0.009 SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) 38 0.011 SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 38 0.011 SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) 37 0.020 SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.081 SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) 35 0.081 SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_49511| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_16012| Best HMM Match : Glyco_hydro_20 (HMM E-Value=0) 33 0.33 SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 33 0.33 SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.57 SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) 30 1.7 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_24733| Best HMM Match : Shugoshin_C (HMM E-Value=4.2) 29 5.3 SB_25340| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_29666| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_15976| Best HMM Match : Vicilin_N (HMM E-Value=5.7) 28 9.3 SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_1582| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 80.2 bits (189), Expect = 2e-15 Identities = 45/97 (46%), Positives = 63/97 (64%), Gaps = 1/97 (1%) Frame = -1 Query: 515 DVREEHKKKYPDVSVIFAAFSKKCAERWNTMSEKEKQRFHEMAEQDKHRFDLEMQNYVPP 336 D RE+ +++ S+ A FSK AE+W MSE+EK+ F + A +DK RF EMQ+Y PP Sbjct: 25 DQREKLQREEGKFSL--ADFSKVSAEKWKNMSEEEKETFVQKAGKDKERFKEEMQSYTPP 82 Query: 335 KDMKVRGRKR-QQMKDPNAPKRSLSAFFCFATMNVRR 228 + +KR +Q KDPN PKR LSA+F F +N++R Sbjct: 83 PSEESGKKKRKKQTKDPNKPKRCLSAYFHF--INLKR 117 Score = 54.0 bits (124), Expect = 1e-07 Identities = 27/87 (31%), Positives = 45/87 (51%) Frame = -3 Query: 324 GQRAKEAADERP*CTKALAISILLFCNDERSKVKAGNPEYTMGDIAKELGRRWAAADPET 145 G++ ++ + P K + F N +R VK NP + G ++K LG W+ + Sbjct: 88 GKKKRKKQTKDPNKPKRCLSAYFHFINLKRDDVKKDNPNASGGALSKVLGEMWSKMTDDD 147 Query: 144 KAKXDALSEKDKARYDREMTAYKKGPL 64 K + +++KDK RY+ EM A+K G L Sbjct: 148 KTQYQDMAKKDKVRYESEMKAFKDGKL 174 Score = 41.5 bits (93), Expect = 7e-04 Identities = 22/69 (31%), Positives = 42/69 (60%) Frame = -1 Query: 509 REEHKKKYPDVSVIFAAFSKKCAERWNTMSEKEKQRFHEMAEQDKHRFDLEMQNYVPPKD 330 R++ KK P+ S A SK E W+ M++ +K ++ +MA++DK R++ EM+ + KD Sbjct: 117 RDDVKKDNPNASG--GALSKVLGEMWSKMTDDDKTQYQDMAKKDKVRYESEMKAF---KD 171 Query: 329 MKVRGRKRQ 303 K+ ++ + Sbjct: 172 GKLPAKQNK 180 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/62 (27%), Positives = 29/62 (46%) Frame = -3 Query: 252 FCNDERSKVKAGNPEYTMGDIAKELGRRWAAADPETKAKXDALSEKDKARYDREMTAYKK 73 F D+R K++ ++++ D +K +W E K + KDK R+ EM +Y Sbjct: 22 FLQDQREKLQREEGKFSLADFSKVSAEKWKNMSEEEKETFVQKAGKDKERFKEEMQSYTP 81 Query: 72 GP 67 P Sbjct: 82 PP 83 >SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 50.0 bits (114), Expect = 2e-06 Identities = 28/83 (33%), Positives = 41/83 (49%) Frame = -3 Query: 321 QRAKEAADERP*CTKALAISILLFCNDERSKVKAGNPEYTMGDIAKELGRRWAAADPETK 142 +R KE +P + + F N R VK +P T +I K LG+ W + PE K Sbjct: 184 KRKKEYDLNKPKAPVTGYVHYVRFLNSRRESVKHQHPHLTFPEITKMLGQEWNSLLPEEK 243 Query: 141 AKXDALSEKDKARYDREMTAYKK 73 K +E+DK RY E+ AY++ Sbjct: 244 QKFLDEAEEDKKRYVEELRAYQQ 266 Score = 42.7 bits (96), Expect = 3e-04 Identities = 24/77 (31%), Positives = 42/77 (54%) Frame = -1 Query: 509 REEHKKKYPDVSVIFAAFSKKCAERWNTMSEKEKQRFHEMAEQDKHRFDLEMQNYVPPKD 330 RE K ++P ++ F +K + WN++ +EKQ+F + AE+DK R+ E++ Y + Sbjct: 212 RESVKHQHPHLT--FPEITKMLGQEWNSLLPEEKQKFLDEAEEDKKRYVEELRAYQQSEQ 269 Query: 329 MKVRGRKRQQMKDPNAP 279 + KRQ +K P Sbjct: 270 YQA-FVKRQHVKRTKHP 285 >SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) Length = 228 Score = 48.0 bits (109), Expect = 8e-06 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 2/87 (2%) Frame = -1 Query: 527 ILCADVREEHKKKYPDVSVIFA--AFSKKCAERWNTMSEKEKQRFHEMAEQDKHRFDLEM 354 + C R ++ + D + + +K A+ WN + EK+ ++EM E+DK R++LEM Sbjct: 64 MFCQQQRTVMQEDHKDATAVMGHHELTKSLAKEWNNLLPDEKKVYYEMYERDKERYELEM 123 Query: 353 QNYVPPKDMKVRGRKRQQMKDPNAPKR 273 + Y K K+Q KDP++ KR Sbjct: 124 KQYSSDKPPS----KKQ--KDPSSKKR 144 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 4/90 (4%) Frame = -3 Query: 336 KGHEGQRAKEAADERP*CTKALAISILLFCNDERSKVKAGNPEYT--MG--DIAKELGRR 169 KG AK+ ++ P K A + +FC +R+ ++ + + T MG ++ K L + Sbjct: 37 KGKSRSSAKQDKEKDPNAPKKPANAFFMFCQQQRTVMQEDHKDATAVMGHHELTKSLAKE 96 Query: 168 WAAADPETKAKXDALSEKDKARYDREMTAY 79 W P+ K + E+DK RY+ EM Y Sbjct: 97 WNNLLPDEKKVYYEMYERDKERYELEMKQY 126 Score = 31.1 bits (67), Expect = 1.00 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 311 KRQQMKDPNAPKRSLSAFFCF 249 K+ + KDPNAPK+ +AFF F Sbjct: 45 KQDKEKDPNAPKKPANAFFMF 65 >SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 45.6 bits (103), Expect = 4e-05 Identities = 22/69 (31%), Positives = 37/69 (53%) Frame = -3 Query: 279 KALAISILLFCNDERSKVKAGNPEYTMGDIAKELGRRWAAADPETKAKXDALSEKDKARY 100 KA + F N++R KV++ +PE ++ K LG W+ + K + +E+DK RY Sbjct: 145 KAPLTGYVQFLNEQREKVRSEHPELPFPEVTKILGAEWSKMSQDDKQRYLDDAERDKERY 204 Query: 99 DREMTAYKK 73 E+ Y+K Sbjct: 205 IIELENYQK 213 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/75 (30%), Positives = 43/75 (57%) Frame = -1 Query: 509 REEHKKKYPDVSVIFAAFSKKCAERWNTMSEKEKQRFHEMAEQDKHRFDLEMQNYVPPKD 330 RE+ + ++P++ F +K W+ MS+ +KQR+ + AE+DK R+ +E++NY Sbjct: 159 REKVRSEHPELP--FPEVTKILGAEWSKMSQDDKQRYLDDAERDKERYIIELENYQKTDA 216 Query: 329 MKVRGRKRQQMKDPN 285 K +K+ + K N Sbjct: 217 YKSFVKKQIERKRKN 231 >SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) Length = 523 Score = 44.8 bits (101), Expect = 8e-05 Identities = 23/82 (28%), Positives = 40/82 (48%) Frame = -3 Query: 318 RAKEAADERP*CTKALAISILLFCNDERSKVKAGNPEYTMGDIAKELGRRWAAADPETKA 139 R ++ A + KA + F N+ R KV++ NP+ ++ + LG W+ K Sbjct: 165 RKRKKAHKDVNAPKAPLTGYVRFLNEHREKVRSENPDLPFHEVTRILGNMWSQLPTPQKQ 224 Query: 138 KXDALSEKDKARYDREMTAYKK 73 +EKDK RY +E+ Y++ Sbjct: 225 LFLEEAEKDKERYMKELEEYQR 246 Score = 35.5 bits (78), Expect = 0.046 Identities = 20/72 (27%), Positives = 37/72 (51%) Frame = -1 Query: 509 REEHKKKYPDVSVIFAAFSKKCAERWNTMSEKEKQRFHEMAEQDKHRFDLEMQNYVPPKD 330 RE+ + + PD+ F ++ W+ + +KQ F E AE+DK R+ E++ Y Sbjct: 192 REKVRSENPDLP--FHEVTRILGNMWSQLPTPQKQLFLEEAEKDKERYMKELEEYQRTDT 249 Query: 329 MKVRGRKRQQMK 294 K+ K++ +K Sbjct: 250 YKMFIAKQKALK 261 >SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) Length = 1204 Score = 37.9 bits (84), Expect = 0.009 Identities = 25/91 (27%), Positives = 41/91 (45%) Frame = -3 Query: 360 GDAELCTTKGHEGQRAKEAADERP*CTKALAISILLFCNDERSKVKAGNPEYTMGDIAKE 181 GD + KG + +R + E P K L+ + +F + ++ ++ NP G+IAK Sbjct: 903 GDTKKKRKKGEKRKRKTKIEGEPP---KPLS-AYQIFFKETQAAIRLQNPSAQFGEIAKI 958 Query: 180 LGRRWAAADPETKAKXDALSEKDKARYDREM 88 +G+ W E K E KA Y + M Sbjct: 959 VGQMWENLPEEQKKVYHCKHETAKAEYQKAM 989 >SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) Length = 299 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/63 (25%), Positives = 35/63 (55%) Frame = -1 Query: 521 CADVREEHKKKYPDVSVIFAAFSKKCAERWNTMSEKEKQRFHEMAEQDKHRFDLEMQNYV 342 C R + KKYP++ + K +++W MSE+ K+ + E E++K ++ ++ +++ Sbjct: 163 CQKHRAKLAKKYPNLKS--TELAAKLSKKWRKMSEERKKAYTEQYEEEKKEYETQLLDFL 220 Query: 341 PPK 333 K Sbjct: 221 KNK 223 Score = 32.3 bits (70), Expect = 0.43 Identities = 14/64 (21%), Positives = 28/64 (43%) Frame = -3 Query: 264 SILLFCNDERSKVKAGNPEYTMGDIAKELGRRWAAADPETKAKXDALSEKDKARYDREMT 85 S +C R+K+ P ++A +L ++W E K E++K Y+ ++ Sbjct: 158 SYFRYCQKHRAKLAKKYPNLKSTELAAKLSKKWRKMSEERKKAYTEQYEEEKKEYETQLL 217 Query: 84 AYKK 73 + K Sbjct: 218 DFLK 221 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/56 (21%), Positives = 26/56 (46%) Frame = -3 Query: 255 LFCNDERSKVKAGNPEYTMGDIAKELGRRWAAADPETKAKXDALSEKDKARYDREM 88 L+ N R + NP+ + + K+L R+W D + K + + +Y +++ Sbjct: 236 LWANQARKDLLVSNPDISAKKLKKKLKRKWKEIDEKGKKTWIKKEKTEMRKYQKKI 291 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 37.5 bits (83), Expect = 0.011 Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 5/81 (6%) Frame = -3 Query: 318 RAKEAADERP*CTKALAISILLFCNDERSKVKA-----GNPEYTMGDIAKELGRRWAAAD 154 R K+A + P K + + + F +D R+K+KA G P ++AK G W + Sbjct: 485 RKKKAKGDGP-VVKRASSAYIHFTSDFRAKLKAKSAKSGTPLPKANEVAKLAGEEWKKLN 543 Query: 153 PETKAKXDALSEKDKARYDRE 91 E K A +E DK RY +E Sbjct: 544 DEQKKPYVAKAEADKQRYLKE 564 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/69 (30%), Positives = 34/69 (49%) Frame = -1 Query: 455 SKKCAERWNTMSEKEKQRFHEMAEQDKHRFDLEMQNYVPPKDMKVRGRKRQQMKDPNAPK 276 +K E W +++++K+ + AE DK R+ +K G K KDP+ PK Sbjct: 532 AKLAGEEWKKLNDEQKKPYVAKAEADKQRY------------LKESG-KNDPKKDPDKPK 578 Query: 275 RSLSAFFCF 249 R +A+F F Sbjct: 579 RPPTAYFLF 587 >SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1361 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/57 (26%), Positives = 32/57 (56%) Frame = -3 Query: 258 LLFCNDERSKVKAGNPEYTMGDIAKELGRRWAAADPETKAKXDALSEKDKARYDREM 88 LLF ++ R ++ +PEY G+I++ +G W A KA+ + ++ ++ + E+ Sbjct: 1276 LLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRNASAARKAEYENKAQMQLSQLETEV 1332 >SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) Length = 145 Score = 36.7 bits (81), Expect = 0.020 Identities = 15/56 (26%), Positives = 31/56 (55%) Frame = -3 Query: 258 LLFCNDERSKVKAGNPEYTMGDIAKELGRRWAAADPETKAKXDALSEKDKARYDRE 91 LLF ++ R ++ +PEY G+I++ +G W A KA+ + ++ ++ + E Sbjct: 43 LLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRNASAARKAEYENKAQMQLSQLETE 98 >SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 34.7 bits (76), Expect = 0.081 Identities = 17/66 (25%), Positives = 33/66 (50%) Frame = -3 Query: 264 SILLFCNDERSKVKAGNPEYTMGDIAKELGRRWAAADPETKAKXDALSEKDKARYDREMT 85 + +++ +ER K+ NP+ +I+K LG W + K ++K +A++ +E Sbjct: 333 AFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLADDDKKPFVEEAKKLRAQHMKEHP 392 Query: 84 AYKKGP 67 YK P Sbjct: 393 DYKYRP 398 >SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) Length = 179 Score = 34.7 bits (76), Expect = 0.081 Identities = 17/66 (25%), Positives = 33/66 (50%) Frame = -3 Query: 264 SILLFCNDERSKVKAGNPEYTMGDIAKELGRRWAAADPETKAKXDALSEKDKARYDREMT 85 + +++ +ER K+ NP+ +I+K LG W + K ++K +A++ +E Sbjct: 16 AFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLADDDKKPFVEEAKKLRAQHMKEHP 75 Query: 84 AYKKGP 67 YK P Sbjct: 76 DYKYRP 81 >SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 33.5 bits (73), Expect = 0.19 Identities = 22/94 (23%), Positives = 43/94 (45%) Frame = -3 Query: 348 LCTTKGHEGQRAKEAADERP*CTKALAISILLFCNDERSKVKAGNPEYTMGDIAKELGRR 169 L + G EG+ E DE + + + +++ ER ++ NPE +++K LG Sbjct: 345 LGSLSGSEGRARTEKDDETERIKRPMN-AFMVWAQVERRRLADANPELHNAELSKMLGLT 403 Query: 168 WAAADPETKAKXDALSEKDKARYDREMTAYKKGP 67 W A + K +E+ + ++ ++ YK P Sbjct: 404 WRALNSTQKRPFVDEAERLRLQHMQDYPNYKYRP 437 >SB_49511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 32.7 bits (71), Expect = 0.33 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = -1 Query: 401 FHEMAEQDKHRFDLEMQNYVPPKDMKVRGRKRQQMKDPNAPKR 273 ++EM E+DK R++LEM+ Y K K+Q KDP++ KR Sbjct: 37 YYEMYERDKERYELEMKQYSSDKPPS----KKQ--KDPSSKKR 73 >SB_16012| Best HMM Match : Glyco_hydro_20 (HMM E-Value=0) Length = 1788 Score = 32.7 bits (71), Expect = 0.33 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Frame = +1 Query: 313 RPLTFMSFGGT*FCISKSNRCLSCSAISWNRCFSF--SDIVFHLSAHFFENAANITLTSG 486 +PLT FGG + +C ++ ++ SDIV L +F E ANIT+ G Sbjct: 1304 QPLTVYHFGGDEVAHGAWTKSSACEQLAQRMGYNLTGSDIVDKLKGYFVERVANITVNDG 1363 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 32.7 bits (71), Expect = 0.33 Identities = 23/86 (26%), Positives = 47/86 (54%) Frame = -1 Query: 515 DVREEHKKKYPDVSVIFAAFSKKCAERWNTMSEKEKQRFHEMAEQDKHRFDLEMQNYVPP 336 DVREE + + P S + S+ +++ ++K++ + + K + + ++V Sbjct: 469 DVREEFESE-PSSSEASGSDSEGESKKKKKEKPEKKRKAEKPPKSPKKK--AKTASFVET 525 Query: 335 KDMKVRGRKRQQMKDPNAPKRSLSAF 258 + +G K++ KDPNAPKR++SA+ Sbjct: 526 GEKGKKGGKKK--KDPNAPKRAMSAY 549 >SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 32.3 bits (70), Expect = 0.43 Identities = 17/66 (25%), Positives = 31/66 (46%) Frame = -3 Query: 264 SILLFCNDERSKVKAGNPEYTMGDIAKELGRRWAAADPETKAKXDALSEKDKARYDREMT 85 + +++ ER K+ +P+ +I+K LG+RW K SE+ + R+ + Sbjct: 51 AFMVWSQIERRKMAEEHPDMHNAEISKRLGKRWKLLSESEKRPFVEESERLRIRHMQAYP 110 Query: 84 AYKKGP 67 YK P Sbjct: 111 DYKYRP 116 >SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/60 (26%), Positives = 29/60 (48%) Frame = -3 Query: 255 LFCNDERSKVKAGNPEYTMGDIAKELGRRWAAADPETKAKXDALSEKDKARYDREMTAYK 76 LF + +K+KA N + DI +ELG +W + + SE + Y+ E+ ++ Sbjct: 383 LFMRENFAKIKAENQGMSNPDIMRELGAKWRNLPFSEREEIRRKSEDAQKTYEAEIVEFE 442 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/55 (32%), Positives = 22/55 (40%) Frame = -3 Query: 306 AADERP*CTKALAISILLFCNDERSKVKAGNPEYTMGDIAKELGRRWAAADPETK 142 A D P K + F D KVK NP +I K L +WA +P K Sbjct: 298 ALDAAPKKHKRPTPAFFRFRQDYADKVKEENPHLKDAEIRKHLSDQWANLEPSVK 352 >SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = -3 Query: 240 ERSKVKAGN-PEYTMGDIAKELGRRWAAADPETKAKXDALSEKDKARYDREMTAYKKGP 67 ER ++K+ P +I+K LG W A E K +++ +A++ RE YK P Sbjct: 22 ERRRIKSQECPRMHNSEISKILGCEWKAMKDELKQPYIEKAKELQAQHSRENPGYKYKP 80 >SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) Length = 367 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 464 AAFSKKCAERWNTMSEKEKQRFHEMAEQDKHRFDLEMQNY-VPPKDMKVRGRKRQQ 300 A SK + WN ++ K+K+ F E AE+ + R E NY PK + R+ Q Sbjct: 122 AEISKLLGKAWNELTTKDKRPFVEKAERLRIRHMKEHPNYRYTPKRRGRQDRRNGQ 177 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/66 (24%), Positives = 30/66 (45%) Frame = -3 Query: 264 SILLFCNDERSKVKAGNPEYTMGDIAKELGRRWAAADPETKAKXDALSEKDKARYDREMT 85 S +++ R K NP+ +I+K LG+ W + K +E+ + R+ +E Sbjct: 100 SFMIWAKVMRRKFAEENPKLHNAEISKLLGKAWNELTTKDKRPFVEKAERLRIRHMKEHP 159 Query: 84 AYKKGP 67 Y+ P Sbjct: 160 NYRYTP 165 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/65 (27%), Positives = 30/65 (46%) Frame = -1 Query: 518 ADVREEHKKKYPDVSVIFAAFSKKCAERWNTMSEKEKQRFHEMAEQDKHRFDLEMQNYVP 339 +D R++ K K + A+ + E +SE EK R E++E+D +L N Sbjct: 3144 SDERDDLKAKLEETEETLASTKENLEETSTKLSETEKLRSSEVSERDSSIEELRTNNENL 3203 Query: 338 PKDMK 324 D+K Sbjct: 3204 RGDLK 3208 >SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 384 Score = 28.7 bits (61), Expect = 5.3 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Frame = -1 Query: 494 KKYPDVSVIFAAFSKKCAERWNTMSEKEKQRFHEMAEQDKHRFDLEMQNYV-PPKDMKVR 318 K+YP + A S + E WN +S ++++ + + A + K + E N+V P+ K Sbjct: 121 KRYPQANN--AEISIRLGEIWNDLSSEQQKPYFDEATRLKDKHKAEHPNWVYQPRPAK-- 176 Query: 317 GRKRQQMKDPNA 282 R+ Q+ P A Sbjct: 177 -RRALQLGTPGA 187 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 28.7 bits (61), Expect = 5.3 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 2/94 (2%) Frame = -1 Query: 569 KAIQQAPRSHDSLCILCADVREEHKKKYPDVSVIFAAFSKKCAERWNTMSEKE--KQRFH 396 K ++A R A +EE K++ + A KK ER EKE K+R Sbjct: 281 KQKEEAERKKQEKLEKLAKKKEELKERKRQEKLEQKA-KKKEKERQEREKEKEREKERIQ 339 Query: 395 EMAEQDKHRFDLEMQNYVPPKDMKVRGRKRQQMK 294 + E+ K R + E Q + K+ K R R++++++ Sbjct: 340 QEKEKQKERREKEKQKHQEKKE-KERQREKEKLE 372 >SB_24733| Best HMM Match : Shugoshin_C (HMM E-Value=4.2) Length = 689 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = -2 Query: 493 RNTLMSVLYLQHSRKSAQRGGIQCRKKKNSGSMRW 389 +++++S LY++ R+ + G+Q RK K G W Sbjct: 28 KSSILSTLYIEEGRQDIYKWGVQ-RKSKRKGIRGW 61 >SB_25340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1105 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +1 Query: 292 SFICCLFRPLTFMSFGGT*FCISKSNRCLSCSAISWNRCFS 414 SF+C R L +SF C+ RC SC+ W RC S Sbjct: 29 SFLC--MRLLEKVSF----LCMRLLKRCHSCACACWKRCHS 63 >SB_29666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 672 QHYRGNLPLYRSCSNRHSSKLYSKQ 598 QH RGN P Y + R +K+ SKQ Sbjct: 129 QHDRGNCPAYNAICRRCKAKVCSKQ 153 >SB_15976| Best HMM Match : Vicilin_N (HMM E-Value=5.7) Length = 128 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -1 Query: 455 SKKCAERWNTMSEKEKQRFHEMAEQDKHR 369 S++C +RW M K+ QR + +D H+ Sbjct: 47 SQRCDKRWPNMRTKDDQRCAQKMTKDAHK 75 >SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 848 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 Query: 479 HQGISSCVLLARLHKECISCHATAG 553 ++G S LH EC+ CH AG Sbjct: 599 NEGYSGTTCEVTLHTECMDCHVNAG 623 >SB_1582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 9.3 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 2/69 (2%) Frame = +3 Query: 282 CIRVFHLLPLSPSDLHVLWW--YIVLHLQVESMLVLFSHLMEPLFFFFRHCIPPLCALFR 455 C ++ + P+ + ++ W YI+L Q+ S ++ FSH P P + L+R Sbjct: 41 CRQILAMFPMMKILVRIINWVGYILLCCQIFSYVIYFSHKTPP-------PEPDMSPLWR 93 Query: 456 ECCKYNTDI 482 +C TD+ Sbjct: 94 KCHSQFTDV 102 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,614,704 Number of Sequences: 59808 Number of extensions: 471120 Number of successful extensions: 1732 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 1524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1725 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -