BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40150 (806 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 25 0.71 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 23 2.2 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 3.8 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 3.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.0 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 25.0 bits (52), Expect = 0.71 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +3 Query: 660 PRFEISKLMGLHGESGWKAKGKAGDKS*TGRRGYELPRSRR 782 PR + S+ G H +S K + K G + T R Y PR+ R Sbjct: 200 PR-QYSQSRGRHNQSRSKRQPKTGREDQTRRNPYYRPRTSR 239 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 23.4 bits (48), Expect = 2.2 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = -2 Query: 175 SFRSNFRSLGTVDKRGADLPLAEHRRSLDIVP-IFASEWVDNLLLNTFFTAL 23 S S+ SL + K A LP+ +H R +VP ++ + + L L +F ++ Sbjct: 2 SLYSSINSLVLISKIFALLPVKKHHRLEKLVPCVYLTSFSVVLSLGSFIVSV 53 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 Query: 335 GWLKNGRLSS 364 GWLK G+LSS Sbjct: 124 GWLKKGKLSS 133 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -2 Query: 445 SRSPYW*NQCRRHVERIHRLSSHQC 371 + P+ ++CR R H L H+C Sbjct: 243 NEKPFECDKCRGRFRRRHHLVHHKC 267 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = +1 Query: 685 WDFTAKAVGRQRGKPETSLKRAGGAMSFPVQGE 783 W + K VGR++ + L + GG + E Sbjct: 1249 WKYKVKCVGRKQLAQKYQLPKMGGPQPYSACSE 1281 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,701 Number of Sequences: 336 Number of extensions: 4322 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21999028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -