BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40149 (852 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 24 1.8 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 7.1 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 7.1 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 7.1 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 23.8 bits (49), Expect = 1.8 Identities = 7/26 (26%), Positives = 16/26 (61%) Frame = +2 Query: 389 ICSEAKWTTLTSALRRMPLISSTVGR 466 + ++KW ++ + MPL++ +GR Sbjct: 413 LAEDSKWRVRSAIIEYMPLLAGQLGR 438 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 410 TTLTSALRRMPLISSTVGRTNRL 478 TT +SAL PLI + +N L Sbjct: 15 TTTSSALNSTPLIEFNISTSNYL 37 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 410 TTLTSALRRMPLISSTVGRTNRL 478 TT +SAL PLI + +N L Sbjct: 15 TTTSSALNSTPLIEFNISTSNYL 37 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.8 bits (44), Expect = 7.1 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = +2 Query: 68 RTRLGDAIDKTSLKILKESYNLADDKNVIASPLGVMLLLSLYESGAG 208 + L A+D +L +NL K+ IA P ++L L + G Sbjct: 619 KINLKHALDLDRQGLLHRQFNLPPAKDTIAVPNNGYVVLRLRANNPG 665 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,430 Number of Sequences: 336 Number of extensions: 5069 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23555563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -