BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40147 (623 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g25490.1 68418.m03033 zinc finger (Ran-binding) family protei... 29 1.9 At3g49290.1 68416.m05387 expressed protein 28 4.4 At3g21290.1 68416.m02690 dentin sialophosphoprotein-related cont... 28 5.8 At5g11660.1 68418.m01363 hypothetical protein many predicted pro... 27 7.7 At1g10390.1 68414.m01171 nucleoporin family protein contains Pfa... 27 7.7 >At5g25490.1 68418.m03033 zinc finger (Ran-binding) family protein contains Pfam domain, PF00641: Zn-finger in Ran binding protein and others Length = 170 Score = 29.5 bits (63), Expect = 1.9 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -2 Query: 172 GRAPWPVGDTPLPRSGLNLLESRGTTELCRRTGSP 68 GR+PW GD PRSG N +E C R +P Sbjct: 128 GRSPWKSGDWICPRSGCNEHNFASRSE-CFRCNAP 161 >At3g49290.1 68416.m05387 expressed protein Length = 312 Score = 28.3 bits (60), Expect = 4.4 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -1 Query: 206 PQPVAKHLTPAGARSLAGGRHATPTFGAESTGVSRNNRAMS*NRFPLLKS 57 P PV K + + + R AT +F + ++ R++S +RFPLL+S Sbjct: 179 PPPVRKSTSQSSSPRQPPQRSATFSFTSTIPKKEQDKRSVSPHRFPLLRS 228 >At3g21290.1 68416.m02690 dentin sialophosphoprotein-related contains weak similarity to Dentin sialophosphoprotein precursor (Swiss-Prot:Q9NZW4) [Homo sapiens] Length = 1192 Score = 27.9 bits (59), Expect = 5.8 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -1 Query: 230 PSFPNLSFPQPVAKHLTPAGARSL--AGGRHATPTFGAESTGV 108 PS SFP P +H +P G S GG A P + ST V Sbjct: 21 PSRNRNSFPPPTNRHPSPIGRMSSGGGGGGSAAPRQRSNSTSV 63 >At5g11660.1 68418.m01363 hypothetical protein many predicted proteins, Arabidopsis thaliana Length = 308 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 198 SGEAPDAGGGALPGRWETRHSHVRG 124 SG +P G G LP E + +HV+G Sbjct: 230 SGISPPMGNGQLPSEDENKSAHVKG 254 >At1g10390.1 68414.m01171 nucleoporin family protein contains Pfam profiles: PF04096 nucleoporin autopeptidase, PF03093 nucleoporin FG repeat family Length = 1041 Score = 27.5 bits (58), Expect = 7.7 Identities = 20/43 (46%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = -1 Query: 230 PSFPNLSFPQ--PVAKHLTPA-GARSLAG-GRHATPTFGAEST 114 P+F N SF P TPA GA S G +TP+FGA ST Sbjct: 133 PAFGNTSFGSSTPFGATNTPAFGAPSTPSFGATSTPSFGASST 175 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,705,362 Number of Sequences: 28952 Number of extensions: 307889 Number of successful extensions: 954 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 953 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -