BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40146 (778 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 26 1.5 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 26 1.5 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 25 2.0 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 4.6 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.8 bits (54), Expect = 1.5 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -1 Query: 631 TCPIRRQREHELLSAPHPHSGDGGNCCLHQTGR 533 T IRRQR L + PHS G ++GR Sbjct: 468 TSTIRRQRRTALGNRDEPHSSSGNWSASSESGR 500 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 25.8 bits (54), Expect = 1.5 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -1 Query: 631 TCPIRRQREHELLSAPHPHSGDGGNCCLHQTGR 533 T IRRQR L + PHS G ++GR Sbjct: 469 TSTIRRQRRTALGNRDEPHSSSGNWSASSESGR 501 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 25.4 bits (53), Expect = 2.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 604 HELLSAPHPHSGDGGN 557 H+LLS P P S GGN Sbjct: 570 HQLLSGPDPRSALGGN 585 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 24.2 bits (50), Expect = 4.6 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 313 RYLQHG*FQACLLQRRRS*IYSLLLGEV*PRELFHLVCRIQIP 441 R L ++CL +RS ++ L+ G++ EL H + R+ P Sbjct: 941 RLLWRNIHRSCLSSLQRSTLFLLVNGKISHGELLHRMNRVPSP 983 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 825,375 Number of Sequences: 2352 Number of extensions: 16804 Number of successful extensions: 50 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -