BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40145 (704 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0532 - 34562151-34562225,34562958-34563161 29 4.8 04_03_0189 + 12444797-12444976,12445057-12445204,12445574-124458... 28 6.3 >03_06_0532 - 34562151-34562225,34562958-34563161 Length = 92 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 127 NNLHYNLKI*HRSTREACHVCMAAWSHFSC 216 N L L+ H +CH+C A S+FSC Sbjct: 61 NQLKMKLQGWHAQMMASCHICSADASNFSC 90 >04_03_0189 + 12444797-12444976,12445057-12445204,12445574-12445874, 12445930-12446144,12446145-12446282,12446414-12446605, 12446740-12446786 Length = 406 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 178 RLPWWTCVISSGCSADCCVSCP 113 +LP WTCV +GC + + P Sbjct: 317 KLPAWTCVAETGCEIEVSIDGP 338 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,791,441 Number of Sequences: 37544 Number of extensions: 427174 Number of successful extensions: 1079 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1049 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1079 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -