BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40142 (753 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 24 1.5 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 23 3.5 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 23 3.5 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 22 6.0 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 21 8.0 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 644 LPARTHKRSPPVPPDIP 594 L TH PPVPP+ P Sbjct: 685 LQVGTHADLPPVPPNFP 701 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 22.6 bits (46), Expect = 3.5 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = -1 Query: 714 PRPFTTRKRIAASPVENRESRVVPTRADSQEVTTSTTRHPFQYLLMSNYL 565 P F + I++ P R ++ T T HPFQ +L+ + L Sbjct: 102 PHRFRLKFNISSIP---RHEKLTAAEIKLTRETAKNTSHPFQRVLVHDIL 148 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 675 PVENRESRVVPTRADSQEVTTSTTRHP 595 P + ES PT+A Q +STT+ P Sbjct: 403 PTQTTESE--PTQASEQPTESSTTQKP 427 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 111 QKFKSSVNKVFYGIVKITPHW 49 QK K V+KVF ++ P+W Sbjct: 75 QKQKEDVHKVFQHLMIHRPNW 95 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 319 CVCLFQNDSQCCKCQLKQCFV 257 CV +N + C C+L++C + Sbjct: 48 CVINKKNRTACKACRLRKCLL 68 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,387 Number of Sequences: 336 Number of extensions: 3670 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -