BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40142 (753 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1B9.02c |sck1||serine/threonine protein kinase Sck1|Schizosa... 27 2.9 SPBC947.01 |||AAA family ATPase, unknown biological role|Schizos... 27 3.8 SPAC23H3.13c |gpa2|git8|heterotrimeric G protein alpha-2 subunit... 26 5.0 SPAC22F8.02c |pvg5|mug50|PvGal biosynthesis protein Pvg5|Schizos... 25 8.8 >SPAC1B9.02c |sck1||serine/threonine protein kinase Sck1|Schizosaccharomyces pombe|chr 1|||Manual Length = 696 Score = 27.1 bits (57), Expect = 2.9 Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 2/34 (5%) Frame = +2 Query: 281 FTALRVVLK*THTQIYLLK--NIIFIY*LKKIHK 376 FTALR++ K T Q+YL++ + IY +KKI K Sbjct: 302 FTALRLIGKGTFGQVYLVRKNDTNRIYAMKKISK 335 >SPBC947.01 |||AAA family ATPase, unknown biological role|Schizosaccharomyces pombe|chr 2|||Manual Length = 660 Score = 26.6 bits (56), Expect = 3.8 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 662 GKAGWYLPARTHKRSPPVPPDIPFSTY 582 G A YL RSPP+ P+ PF+++ Sbjct: 163 GDAPSYLAPSKPNRSPPLKPEDPFASF 189 >SPAC23H3.13c |gpa2|git8|heterotrimeric G protein alpha-2 subunit Gpa2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 354 Score = 26.2 bits (55), Expect = 5.0 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -3 Query: 214 VNSKLIKQIHATTLK*KFSFKIVLLNKDHRG-SCISK 107 +NSK+ KQI + K K +K++LL G S ISK Sbjct: 16 LNSKIEKQIENASKKDKKIYKVLLLGASDSGKSTISK 52 >SPAC22F8.02c |pvg5|mug50|PvGal biosynthesis protein Pvg5|Schizosaccharomyces pombe|chr 1|||Manual Length = 372 Score = 25.4 bits (53), Expect = 8.8 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = +1 Query: 37 RHLAPVRRNFYYPIE 81 RHL+ ++RNFYY ++ Sbjct: 53 RHLSALKRNFYYTMD 67 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,909,969 Number of Sequences: 5004 Number of extensions: 57926 Number of successful extensions: 109 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 109 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 359287726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -