BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40142 (753 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 29 5.2 09_02_0322 - 7240125-7241568,7242043-7243253,7245782-7246144,724... 28 6.9 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 644 LPARTHKRSPPVPPDIPFST 585 LPA +KR+PP PP P T Sbjct: 738 LPAAANKRNPPAPPPPPLMT 757 >09_02_0322 - 7240125-7241568,7242043-7243253,7245782-7246144, 7246502-7246522 Length = 1012 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -2 Query: 713 PGPLQPGNALLLPR*KIGKAGWYLPAR-THKRSPP 612 PG P +A L+P K G A YL + H++ PP Sbjct: 681 PGSYNPASAHLVPPYKFGNAPSYLESELAHQKHPP 715 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,606,275 Number of Sequences: 37544 Number of extensions: 352966 Number of successful extensions: 805 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 803 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2004270760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -