BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40141 (924 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4CU93 Cluster: Putative uncharacterized protein; n=4; ... 36 1.9 UniRef50_A2QEJ2 Cluster: Catalytic activity: 1-phosphatidyl-1D-m... 34 5.9 UniRef50_Q2JY04 Cluster: Putative uncharacterized protein; n=2; ... 33 7.8 >UniRef50_Q4CU93 Cluster: Putative uncharacterized protein; n=4; Trypanosoma|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 252 Score = 35.5 bits (78), Expect = 1.9 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +2 Query: 656 EEERVYDPSFSKILDTQILTQILWIGHGMIPGILLYTGRLFQ 781 EEE ++ +F K +T++L +L GH IP I L T R+F+ Sbjct: 92 EEEMIFAAAFQKTTNTRLLRLVLSDGHSEIPAIELTTLRVFR 133 >UniRef50_A2QEJ2 Cluster: Catalytic activity: 1-phosphatidyl-1D-myo-inositol 4; n=1; Aspergillus niger|Rep: Catalytic activity: 1-phosphatidyl-1D-myo-inositol 4 - Aspergillus niger Length = 594 Score = 33.9 bits (74), Expect = 5.9 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = -3 Query: 706 LGIQNFGKAWVVNAFLLLGPSSWPLKYQGR*SSKCSPG 593 L QNF KA ++NA + G W LK G SS PG Sbjct: 406 LNWQNFDKAMMLNAGMFAGEQGWVLKPPGYRSSDAQPG 443 >UniRef50_Q2JY04 Cluster: Putative uncharacterized protein; n=2; Synechococcus|Rep: Putative uncharacterized protein - Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacteriumYellowstone A-Prime) Length = 273 Score = 33.5 bits (73), Expect = 7.8 Identities = 17/60 (28%), Positives = 25/60 (41%), Gaps = 3/60 (5%) Frame = +1 Query: 658 GGTRLRPKLFQNSGYPNFNPNPVDW---PWNDSRNIALYWEVIPEKVQSDCLGNFWGSKP 828 GG L N P FN + W + +Y++V+PE LG +WG+ P Sbjct: 154 GGRLAGMHLIDNPEEPGFNLRQLQRLVRAWFPDNRLMVYYQVLPEDPDQQVLGAYWGTVP 213 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 937,486,955 Number of Sequences: 1657284 Number of extensions: 19910132 Number of successful extensions: 49443 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 47245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49425 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 84851082477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -