BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40141 (924 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3G6.06c |rad2|fen1|FEN-1 endonuclease|Schizosaccharomyces po... 29 0.70 SPBC21.02 |||TLDc domain protein 2|Schizosaccharomyces pombe|chr... 28 2.1 SPCC645.10 |||ATP|Schizosaccharomyces pombe|chr 3|||Manual 26 8.6 >SPAC3G6.06c |rad2|fen1|FEN-1 endonuclease|Schizosaccharomyces pombe|chr 1|||Manual Length = 380 Score = 29.5 bits (63), Expect = 0.70 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 715 PNPVDWPWNDSRNIALYWEVIP 780 P P DWP+ D+R + L EV+P Sbjct: 270 PIPEDWPYEDARRLFLDAEVLP 291 >SPBC21.02 |||TLDc domain protein 2|Schizosaccharomyces pombe|chr 2|||Manual Length = 511 Score = 27.9 bits (59), Expect = 2.1 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -2 Query: 809 LPKQSLWTFSGITSQYKAIFRESFHGQS 726 LPK S+W +G+TS +FR SFHG S Sbjct: 288 LPK-SVWQVNGLTS----LFRASFHGYS 310 >SPCC645.10 |||ATP|Schizosaccharomyces pombe|chr 3|||Manual Length = 484 Score = 25.8 bits (54), Expect = 8.6 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -2 Query: 305 CSSTNIMLW*RVF*KSW*FVFKLYVVYDIS*TPVSKIKSYISDHNA 168 CSS ++ R KSW VF V+Y TP + + + S + + Sbjct: 373 CSSIGSLI--RQLNKSWEVVFLTSVIYSCCKTPAASVSNTFSSYKS 416 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,975,587 Number of Sequences: 5004 Number of extensions: 87851 Number of successful extensions: 232 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 232 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 467341524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -