BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40140 (893 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC569.03 |||DUF1773 family protein 4|Schizosaccharomyces pombe... 29 1.2 SPAC25A8.02 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 26 8.3 >SPCC569.03 |||DUF1773 family protein 4|Schizosaccharomyces pombe|chr 3|||Manual Length = 396 Score = 28.7 bits (61), Expect = 1.2 Identities = 10/48 (20%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Frame = +2 Query: 98 LEEVRKSLEDLNTNVFALKGELNSL--QQNTFRCSLDTIKGDIASVKG 235 + E++ + + ++ ++KGE+ + + + +D++KG++A +KG Sbjct: 189 MAEMKGEMTVMKNDIASIKGEMAEMKGEMTIMKSDIDSVKGEMAEMKG 236 >SPAC25A8.02 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 390 Score = 25.8 bits (54), Expect = 8.3 Identities = 11/52 (21%), Positives = 28/52 (53%) Frame = +2 Query: 35 KNCVRHLIFVDQPKRKTTNECLEEVRKSLEDLNTNVFALKGELNSLQQNTFR 190 ++C++ ++ KR + +E + + L + F+LKG++ ++ T+R Sbjct: 19 ESCLKKQLYDFYHKRDEFSRDIESELEKVAKLKSESFSLKGKITQKEELTYR 70 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,450,334 Number of Sequences: 5004 Number of extensions: 69810 Number of successful extensions: 167 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 167 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 450492750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -