BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40138 (877 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 6.5 AJ308527-1|CAC33429.1| 57|Apis mellifera defensin protein. 22 6.5 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 22.2 bits (45), Expect = 6.5 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +1 Query: 748 YKFQTYVNQNMISVIFSCKLSPPLYKCDINLGIIYV 855 Y+ +T + I +C++ LY DI + IY+ Sbjct: 99 YRNKTVKYSARMHAIIACQMEFQLYPMDIQICPIYI 134 >AJ308527-1|CAC33429.1| 57|Apis mellifera defensin protein. Length = 57 Score = 22.2 bits (45), Expect = 6.5 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +3 Query: 507 RGHEQDARCGAQRHARRNAGWHARR 581 +G D+ C A H+ AG H + Sbjct: 27 KGQVNDSACAANCHSLGKAGGHCEK 51 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 236,710 Number of Sequences: 438 Number of extensions: 5442 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28402218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -