BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40136 (542 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14338| Best HMM Match : Spore_permease (HMM E-Value=0.75) 30 1.4 SB_24645| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_14338| Best HMM Match : Spore_permease (HMM E-Value=0.75) Length = 367 Score = 29.9 bits (64), Expect = 1.4 Identities = 19/69 (27%), Positives = 39/69 (56%), Gaps = 2/69 (2%) Frame = +2 Query: 2 IITTIVCC--SPLKY*FVVQLLKCKFLFRMKITLLSVVIFCAVFVLSSECELSDIVSARI 175 I++TI+ C + + + ++ C+ L +M +++LS++I C + + S C LS I+ R+ Sbjct: 102 ILSTIIVCRLTNVSVCILSIIIVCR-LTKMSVSILSIIIVCRLSNV-SVCILSIIIVCRL 159 Query: 176 ESCRGCSLN 202 C L+ Sbjct: 160 TKVSVCILS 168 >SB_24645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 27.1 bits (57), Expect = 9.9 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +2 Query: 296 SSLERETMSSRDYLYLISIRNSAMNLYRA 382 S + R+T S D+L LIS+ +A N+Y A Sbjct: 162 SGITRKTEDSADWLRLISLCPAATNMYDA 190 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,912,892 Number of Sequences: 59808 Number of extensions: 310548 Number of successful extensions: 627 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 580 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1239956166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -