BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40135 (889 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g23000.1 68417.m03318 calcineurin-like phosphoesterase family... 30 2.4 At1g03190.2 68414.m00297 DNA repair protein / transcription fact... 29 5.4 At1g03190.1 68414.m00296 DNA repair protein / transcription fact... 29 5.4 At3g01770.1 68416.m00116 DNA-binding bromodomain-containing prot... 28 7.2 >At4g23000.1 68417.m03318 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 calcineurin-like phosphoesterase Length = 932 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -1 Query: 865 GRNFKSPTLVFKWFTRSSFTSTNGKSAHPSLRHKSKVS-GN 746 G F PT VF+ F++ S KSA+PS S+++ GN Sbjct: 666 GGAFLHPTHVFRCFSKFYGASYESKSAYPSFEDSSRIALGN 706 >At1g03190.2 68414.m00297 DNA repair protein / transcription factor protein (UVH6) identical to DNA repair/transcription factor protein (UVH6) gi:22651569 gb:AY090788 Length = 758 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -2 Query: 864 DGTSKAQPWCLSGLRGAHLRLPTEKA 787 D SK W LS LR AHL L T+ A Sbjct: 688 DKRSKLPGWILSHLRDAHLNLSTDMA 713 >At1g03190.1 68414.m00296 DNA repair protein / transcription factor protein (UVH6) identical to DNA repair/transcription factor protein (UVH6) gi:22651569 gb:AY090788 Length = 758 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -2 Query: 864 DGTSKAQPWCLSGLRGAHLRLPTEKA 787 D SK W LS LR AHL L T+ A Sbjct: 688 DKRSKLPGWILSHLRDAHLNLSTDMA 713 >At3g01770.1 68416.m00116 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 620 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 771 DISPRSQVIVTNGCPGPSKPKHTTASRQKTRPGRWXLP 658 D+ P S+++ + S+PK SR T PG+ LP Sbjct: 76 DLLPISKIVTSTPASNVSRPKSFGMSRCSTGPGKRVLP 113 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,070,220 Number of Sequences: 28952 Number of extensions: 403885 Number of successful extensions: 1057 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1026 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1057 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2081245872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -