BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40133 (873 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY113406-1|AAM29411.1| 485|Drosophila melanogaster RE12890p pro... 30 4.8 AE014296-871|AAN11609.1| 485|Drosophila melanogaster CG32243-PA... 30 4.8 >AY113406-1|AAM29411.1| 485|Drosophila melanogaster RE12890p protein. Length = 485 Score = 29.9 bits (64), Expect = 4.8 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +2 Query: 272 CQLIHTYYTTSFCFVLFRVILVVYRYHPLW 361 CQ++ Y+ T +L+++IL + ++HP W Sbjct: 410 CQMLKYYFPTES--ILYQIILCISKHHPKW 437 >AE014296-871|AAN11609.1| 485|Drosophila melanogaster CG32243-PA protein. Length = 485 Score = 29.9 bits (64), Expect = 4.8 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +2 Query: 272 CQLIHTYYTTSFCFVLFRVILVVYRYHPLW 361 CQ++ Y+ T +L+++IL + ++HP W Sbjct: 410 CQMLKYYFPTES--ILYQIILCISKHHPKW 437 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,630,381 Number of Sequences: 53049 Number of extensions: 576053 Number of successful extensions: 824 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 800 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 824 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4229643912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -