BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40132 (884 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0767 + 27121761-27123335,27123701-27123910,27124843-271249... 29 3.8 05_01_0148 - 985745-986180,986290-986385,986498-986694,986824-98... 29 5.0 01_05_0290 - 20487105-20487113,20487171-20487213,20488336-204884... 29 5.0 05_04_0028 + 17302359-17302445,17303887-17303952,17305415-173054... 29 6.6 06_03_1176 - 28172230-28172547,28172691-28172849,28172962-28174194 28 8.7 >11_06_0767 + 27121761-27123335,27123701-27123910,27124843-27124911, 27125387-27125656,27126027-27126377,27126480-27126757, 27126887-27128330 Length = 1398 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 548 KGRHQSRSWEPSSSKTESRYRARSRS 625 + R +SRSW S S++ S R+RSRS Sbjct: 1250 RSRSRSRSWSRSRSRSRSPSRSRSRS 1275 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 548 KGRHQSRSWEPSSSKTESRYRARSRS 625 + R +SRSW S S++ S R+RSRS Sbjct: 1240 RSRSRSRSWSRSRSRSRSWSRSRSRS 1265 >05_01_0148 - 985745-986180,986290-986385,986498-986694,986824-986919, 987020-987059,987751-987857 Length = 323 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +2 Query: 545 KKGRHQSRSWEPSSSKTESRYRARSRSV 628 ++GR +SRS+ S S++ S R+RSRS+ Sbjct: 159 RRGRGRSRSYSRSRSRSRSYSRSRSRSL 186 >01_05_0290 - 20487105-20487113,20487171-20487213,20488336-20488412, 20489096-20489163,20489266-20489456,20490687-20490798, 20490892-20490943,20491984-20492076,20493065-20493211, 20493381-20493410,20493764-20493862,20495188-20495322, 20495420-20495498,20495989-20496064,20496345-20496423, 20496513-20496547,20497185-20497259,20497405-20497804 Length = 599 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 625 SPGTPLSMGDIPEQRVGQRLWPSGDYM 705 SP TP + +P R+ ++ W SGDY+ Sbjct: 96 SPSTPSTKVALPAPRLCRQFWKSGDYV 122 >05_04_0028 + 17302359-17302445,17303887-17303952,17305415-17305489, 17305638-17305737,17305819-17305865,17305937-17305994, 17306161-17306210,17306417-17306473,17306561-17306703, 17306793-17306834,17307083-17307124,17308239-17308272, 17308342-17308443,17310373-17310652,17311202-17311332, 17311676-17311773,17312525-17312717 Length = 534 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +2 Query: 548 KGRHQSRSWEPSSSKTESRYRARSRSVQARRCP 646 +GR SRS S S++ S R+RSRS R P Sbjct: 195 RGRSHSRSISRSRSRSRSISRSRSRSYSRSRSP 227 >06_03_1176 - 28172230-28172547,28172691-28172849,28172962-28174194 Length = 569 Score = 28.3 bits (60), Expect = 8.7 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +3 Query: 720 RGTAGNGNLNGCSVARIWLRTSSPPDGDTLTAKFQSFPSSRVTTYG--SSFK 869 R TAG +L + +L + S PD D+L F FP S+ TT G +SFK Sbjct: 342 RLTAGK-HLRSFRYSGNFLTSLSLPDNDSLADLFIGFPRSQSTTPGPENSFK 392 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,098,308 Number of Sequences: 37544 Number of extensions: 585331 Number of successful extensions: 1523 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1518 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2503236492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -