BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40131 (877 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 3.7 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 22 8.5 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 3.7 Identities = 9/45 (20%), Positives = 20/45 (44%) Frame = +1 Query: 718 LLGAAKSSWVRVIPALNWQADWIWHSASXVG*WYPLVEPNCPSWK 852 L + W+ ++P ++ A ++H + P + P+WK Sbjct: 379 LRNGCPADWLWIVPPISGSATPVFHQEMALYYLKPSYDAQEPAWK 423 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.8 bits (44), Expect = 8.5 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +1 Query: 640 KTVGWTFWENYGVMARGAQPKHHSWPLLGAAKSSWVRVIP 759 K +G T + RG + + W GA SW V+P Sbjct: 148 KNLGGTTLHHGMAYHRGHRKDYERWVQQGAFGWSWDEVMP 187 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 262,144 Number of Sequences: 438 Number of extensions: 6081 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28402218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -