BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40127 (444 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 23 4.9 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 6.4 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 6.4 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.0 bits (47), Expect = 4.9 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 103 KPTVSKTEIREKLAKMYKVTPDVVFVFGFK 192 KPT+ I EKL K K D V ++ F+ Sbjct: 49 KPTIHFAYIIEKLYKRLKSKGDYVGIYFFR 78 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 22.6 bits (46), Expect = 6.4 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -1 Query: 135 LTDLGLADGWFSWM*NIANHAAC 67 L+ LG DG SW+ + ++ +C Sbjct: 632 LSKLGFGDGIISWLSSYLSNRSC 654 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 6.4 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +3 Query: 300 EKKRPTRKQRKERKNRMKKV 359 +KK PT+KQ K+ + ++ K+ Sbjct: 402 QKKLPTKKQHKQLQAQLDKL 421 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 490,421 Number of Sequences: 2352 Number of extensions: 9928 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37418568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -