BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40127 (444 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 24 0.65 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 3.5 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 6.1 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 8.0 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 8.0 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 24.2 bits (50), Expect = 0.65 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 106 VFLDVKHRKPCCLRANNLLVMNLRVRIVAVPSLIL 2 VFL K R+PC +L V +L V ++ +P +L Sbjct: 66 VFLVRKLRRPCNYLLVSLAVSDLCVALLVMPMALL 100 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 3.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 190 KTNFGGGKSTGFALIYDTLDLA 255 KTN G S+G L+ + D+A Sbjct: 724 KTNLSGDSSSGTTLLLELDDIA 745 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.0 bits (42), Expect = 6.1 Identities = 6/22 (27%), Positives = 13/22 (59%) Frame = -1 Query: 288 GGLTCAWARTSCQIECVVDQSE 223 GGL W+R ++ ++++E Sbjct: 384 GGLEAQWSRVLGRVHATIERNE 405 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.6 bits (41), Expect = 8.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 88 VLHPGKPTVSKTEIREK 138 +LHP + T K REK Sbjct: 15 LLHPSRCTQGKVNYREK 31 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.6 bits (41), Expect = 8.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 88 VLHPGKPTVSKTEIREK 138 +LHP + T K REK Sbjct: 15 LLHPSRCTQGKVNYREK 31 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,521 Number of Sequences: 438 Number of extensions: 2725 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11574126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -