BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40126 (725 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 23 3.3 AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. 21 7.7 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 22.6 bits (46), Expect = 3.3 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 109 SKLECQSI*SSDQTFTTPSVPPDTKYLPQGDIS 11 S + + + S T TPS PP+ + P D S Sbjct: 84 SPILAEKVSVSPTTPPTPSPPPEERLTPSKDAS 116 >AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. Length = 257 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/40 (22%), Positives = 21/40 (52%) Frame = +2 Query: 239 PDKIFGEKTNNEAVDSSSDDSINQYDIRYSSHSENCLTFW 358 PD +FG+ +E V S + N+ ++ ++ + + +W Sbjct: 207 PDTVFGDDGKSEDVPVISLKNENELPQQHKTNVMDVMQWW 246 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,837 Number of Sequences: 336 Number of extensions: 4153 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -