BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40126 (725 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_38974| Best HMM Match : WD40 (HMM E-Value=1.1e-19) 31 0.72 SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41) 31 0.95 SB_20382| Best HMM Match : WD40 (HMM E-Value=1.7e-23) 31 0.95 SB_44731| Best HMM Match : WD40 (HMM E-Value=1.1e-11) 31 1.3 SB_9416| Best HMM Match : WD40 (HMM E-Value=0) 31 1.3 SB_39225| Best HMM Match : NIF (HMM E-Value=0) 30 1.7 SB_12300| Best HMM Match : UCH (HMM E-Value=6e-18) 30 1.7 SB_41443| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_39121| Best HMM Match : Band_41 (HMM E-Value=1.7e-08) 30 2.2 SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0) 30 2.2 SB_43298| Best HMM Match : WD40 (HMM E-Value=1.7e-30) 29 2.9 SB_52292| Best HMM Match : WD40 (HMM E-Value=1.6e-09) 29 3.8 SB_50898| Best HMM Match : UCH (HMM E-Value=6.9) 29 3.8 SB_48711| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_3361| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 5.1 SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_30344| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_48737| Best HMM Match : WD40 (HMM E-Value=1.5e-36) 29 5.1 SB_27472| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_20511| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_12715| Best HMM Match : Adeno_E1A (HMM E-Value=1.3) 29 5.1 SB_8527| Best HMM Match : zf-C2H2 (HMM E-Value=4.3e-21) 29 5.1 SB_34680| Best HMM Match : WD40 (HMM E-Value=4.5e-07) 28 6.7 SB_14988| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-08) 28 6.7 SB_19258| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_22092| Best HMM Match : WD40 (HMM E-Value=7.2e-07) 28 8.9 SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061) 28 8.9 SB_48871| Best HMM Match : WD40 (HMM E-Value=0.0073) 28 8.9 SB_47540| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_30331| Best HMM Match : Amidase (HMM E-Value=0) 28 8.9 SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35) 28 8.9 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 35.9 bits (79), Expect = 0.033 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 3/60 (5%) Frame = +3 Query: 15 ISPCGRYLVSGGTDGVVKVWSLDHIDWHSSL---DPVNNTTDDVTYKFPLYKDCCNSISI 185 I P G Y++SG +D ++VWSLD D + + PV V K L+ C NS+ + Sbjct: 233 IYPFGSYIMSGSSDNTIRVWSLDMSDEVNRIHTNQPVKG-LGSVVGKDNLFSFCRNSLDL 291 >SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1649 Score = 32.7 bits (71), Expect = 0.31 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +3 Query: 15 ISPCGRYLVSGGTDGVVKVW 74 + PCGRYLV+G D ++++W Sbjct: 1586 VLPCGRYLVTGSRDKILRLW 1605 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 15 ISPCGRYLVSGGTDGVVKVWSLD 83 +SP +LVSG D VK+W +D Sbjct: 756 LSPHADFLVSGAFDHTVKIWDMD 778 Score = 28.3 bits (60), Expect = 6.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 15 ISPCGRYLVSGGTDGVVKVWSLD 83 ++P G ++S G D VKVWSL+ Sbjct: 924 VTPDGSKVISSGDDTQVKVWSLE 946 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSLDHIDWHSSLDPVNNTTD 131 SP ++ +SG D +VK+W L+ SL V +T+D Sbjct: 883 SPDDKFAISGSEDTMVKIWDLESAKEVRSL--VGHTSD 918 >SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 31.9 bits (69), Expect = 0.54 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSLDHIDWHSS 104 SP GR+++SGG DG KV+ + I + S Sbjct: 189 SPDGRWIISGGEDGAAKVYGWEPIKCYES 217 >SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 31.5 bits (68), Expect = 0.72 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWS 77 SP G+YLV+G DG ++VW+ Sbjct: 223 SPDGQYLVTGSVDGFIEVWN 242 >SB_38974| Best HMM Match : WD40 (HMM E-Value=1.1e-19) Length = 584 Score = 31.5 bits (68), Expect = 0.72 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSLDHI 89 SP G+Y+V+GG D ++ VWS + Sbjct: 325 SPDGKYVVTGGEDDLITVWSFHEL 348 >SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41) Length = 1487 Score = 31.1 bits (67), Expect = 0.95 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWS 77 SP G Y+ +GG DG VK+W+ Sbjct: 1260 SPDGNYIATGGDDGKVKLWN 1279 >SB_20382| Best HMM Match : WD40 (HMM E-Value=1.7e-23) Length = 437 Score = 31.1 bits (67), Expect = 0.95 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 12 DISPCGRYLVSGGTDGVVKVWSLDHIDWHSSL 107 DIS +V+G D +K+W LD D H S+ Sbjct: 253 DISSDSTLIVTGSADKNIKIWGLDFGDCHKSI 284 >SB_44731| Best HMM Match : WD40 (HMM E-Value=1.1e-11) Length = 256 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSLDHI 89 SP G L SGG DG V+VW + Sbjct: 190 SPDGTLLASGGMDGAVRVWDFGQV 213 >SB_9416| Best HMM Match : WD40 (HMM E-Value=0) Length = 700 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/65 (27%), Positives = 33/65 (50%) Frame = +3 Query: 24 CGRYLVSGGTDGVVKVWSLDHIDWHSSLDPVNNTTDDVTYKFPLYKDCCNSISIHPYRPI 203 C ++ SGG D + +W ++ + ++L NNT T KD S++++P + Sbjct: 129 CKEHVASGGLDKQIFLWDVNTL---TALTATNNTV--TTSSLSGQKDSIYSLAMNPAGTV 183 Query: 204 LATGS 218 L +GS Sbjct: 184 LISGS 188 >SB_39225| Best HMM Match : NIF (HMM E-Value=0) Length = 1772 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/61 (24%), Positives = 29/61 (47%) Frame = +3 Query: 39 VSGGTDGVVKVWSLDHIDWHSSLDPVNNTTDDVTYKFPLYKDCCNSISIHPYRPILATGS 218 ++ G G++ W L + + DP T+D+ Y L+ C+S+ +P + + G Sbjct: 511 LAAGEQGLLS-WILRRLKLYKRYDPT--TSDETEYMENLFNCLCSSLMFNPNKDLFLRGE 567 Query: 219 G 221 G Sbjct: 568 G 568 >SB_12300| Best HMM Match : UCH (HMM E-Value=6e-18) Length = 457 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSLDHIDWHSSLD---PVNNTTDDVTYKFPLYKDCCNSIS 182 SPCG SG ++G S+D D S++D P ++D P K+C N+ S Sbjct: 395 SPCGTETDSGVSEGYSDGVSIDDDDVGSNIDNEQPSVRASNDAAQHLPNAKECFNASS 452 >SB_41443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 30.3 bits (65), Expect = 1.7 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVW 74 SP G+YL SGG D ++ +W Sbjct: 300 SPDGKYLASGGNDNLLNIW 318 >SB_39121| Best HMM Match : Band_41 (HMM E-Value=1.7e-08) Length = 558 Score = 29.9 bits (64), Expect = 2.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 3 IYFDISPCGRYLVSGGTDGVVKVWSLD 83 I+ +S CG ++ SG DG+ VW+ D Sbjct: 169 IHSAMSACGSFVFSGSEDGLAYVWNTD 195 >SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0) Length = 2376 Score = 29.9 bits (64), Expect = 2.2 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = +2 Query: 176 HINSSI*THIGYRIWPISFHRPDKIFGEKTNNEAVDSSSDDSINQYDIRYSSHS 337 H N S HI I F R K+FG +N V+++ +YDI SH+ Sbjct: 2113 HCNHS--KHIMMAIHKPDFIRAFKLFGNHLHNSGVNNAKSAIKERYDINEGSHT 2164 >SB_43298| Best HMM Match : WD40 (HMM E-Value=1.7e-30) Length = 685 Score = 29.5 bits (63), Expect = 2.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVW 74 SP G+ L SGG D VV +W Sbjct: 480 SPDGKLLASGGNDNVVNIW 498 >SB_52292| Best HMM Match : WD40 (HMM E-Value=1.6e-09) Length = 743 Score = 29.1 bits (62), Expect = 3.8 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 24 CGRYLVSGGTDGVVKVWSLDHIDWHSSLDPVNNT 125 CG +LV+G + G VK W + + P N T Sbjct: 371 CGNFLVAGTSQGYVKCWDVSRREAKQHCTPKNLT 404 >SB_50898| Best HMM Match : UCH (HMM E-Value=6.9) Length = 176 Score = 29.1 bits (62), Expect = 3.8 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSLDHIDWHSSLD---PVNNTTDDVTYKFPLYKDCCN 173 SPCG SG ++G S+D D S++D P ++D P K+C N Sbjct: 114 SPCGTETDSGVSEGYSDGVSIDDDDVGSNIDNEQPSVRASNDAAQHLPNAKECFN 168 >SB_48711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 29.1 bits (62), Expect = 3.8 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 15 ISPCGRYLVSGGTDGVVKVWSLD 83 I+ G+YL SGG D ++++W D Sbjct: 122 ITTDGKYLASGGKDKLIRIWDPD 144 >SB_3361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSLDHIDW-HSSLDP 113 SP GR +VSG D +K+W D H+ DP Sbjct: 79 SPDGRLIVSGSDDKTIKLWDRTSKDCVHTFYDP 111 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 310 LVNRIIRTRIYGFIIRFLTKDFIGSV 233 +V R++R RIY IRF KD+ G + Sbjct: 807 VVTRVLRPRIYCRFIRFYPKDWYGHI 832 >SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 28.7 bits (61), Expect = 5.1 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 15 ISPCGRYLVSGGTDGVVKVWSL 80 +SPCGR++ S G VK+W + Sbjct: 248 LSPCGRFVASAGFTPDVKLWEV 269 >SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1803 Score = 28.7 bits (61), Expect = 5.1 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 6 YFDISPCGRYLVSGGTDGVVKVWSLD 83 Y + SP G +++S D +VW D Sbjct: 1639 YTEFSPSGEFIISSSIDNTAQVWRFD 1664 >SB_30344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 418 Score = 28.7 bits (61), Expect = 5.1 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +3 Query: 27 GRYLVSGGTDGVVKVWS 77 G +L+S G+DG V++WS Sbjct: 402 GEFLLSSGSDGTVRIWS 418 >SB_48737| Best HMM Match : WD40 (HMM E-Value=1.5e-36) Length = 885 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = +3 Query: 27 GRYLVSGGTDGVVKVWSLDH-IDWHSS-LDPVNNTTDDV-TYKFPLYKDCCNSISIH 188 G+ +S G D +VK WS+ + +D ++ L+P+ V + P KDC +I+ H Sbjct: 121 GQSFISVGDDKIVKQWSMSNALDGTTTKLEPLQTILGKVKLWNLPT-KDCLRTITAH 176 >SB_27472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 12 DISPCGRYLVSGGTDGVVKVWSLDHIDWHSS 104 + SP G Y++SG DG + +W DW S+ Sbjct: 9 NFSPDGSYVISGDADGKLNIW-----DWKST 34 >SB_20511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +2 Query: 254 GEKTNNEAVDSSSDDSINQYDIRYSSHSENCLTFWWTGDVIELNKNL 394 G T+N A++SSS D+ +QY + EN + + G L K L Sbjct: 221 GMGTSNSAIESSSADTYSQYKFAMTQFEENPIAPY--GQAFGLTKQL 265 >SB_12715| Best HMM Match : Adeno_E1A (HMM E-Value=1.3) Length = 909 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = -2 Query: 175 LLQQSLYKGNL*VTSSVVLLTGSKLECQSI*SSDQTFTTPS 53 LL QS ++ N V SSV LL S+ EC I S+ T S Sbjct: 212 LLSQSRHEDNESVPSSVTLLNQSRNECGEIDPSNVTLLNQS 252 >SB_8527| Best HMM Match : zf-C2H2 (HMM E-Value=4.3e-21) Length = 1049 Score = 28.7 bits (61), Expect = 5.1 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWS 77 S GR + S TDG+VKVW+ Sbjct: 765 SSSGRTIASADTDGIVKVWT 784 >SB_34680| Best HMM Match : WD40 (HMM E-Value=4.5e-07) Length = 454 Score = 28.3 bits (60), Expect = 6.7 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +3 Query: 30 RYLVSGGTDGVVKVWSL 80 +YL +G DGVV++WSL Sbjct: 397 QYLAAGYNDGVVRIWSL 413 >SB_14988| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-08) Length = 619 Score = 28.3 bits (60), Expect = 6.7 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 254 GEKTNNEAVDSSSDDSINQYD 316 GE+ N++A D SS+D IN +D Sbjct: 130 GEEANDDANDYSSEDDINSHD 150 >SB_19258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 459 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWS 77 SP GRYL SG D V +WS Sbjct: 342 SPDGRYLASGSFDKRVHIWS 361 >SB_22092| Best HMM Match : WD40 (HMM E-Value=7.2e-07) Length = 338 Score = 27.9 bits (59), Expect = 8.9 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +3 Query: 33 YLVSGGTDGVVKVWSL 80 YLV+G DG++KVW + Sbjct: 70 YLVTGDADGLIKVWDI 85 >SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061) Length = 1445 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = -3 Query: 255 PKILSGL*NDIGQIR*PIWVYMDELICYCSNLCIKETYK 139 P+I G + Q+R P W D ++ C +TY+ Sbjct: 1219 PRISGGRQKGVDQLRGPFWGKCDYIVLVCPTFVYNKTYE 1257 >SB_48871| Best HMM Match : WD40 (HMM E-Value=0.0073) Length = 614 Score = 27.9 bits (59), Expect = 8.9 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +3 Query: 33 YLVSGGTDGVVKVWSL 80 YLV+G DG++KVW + Sbjct: 70 YLVTGDADGLIKVWDI 85 >SB_47540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 622 Score = 27.9 bits (59), Expect = 8.9 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +3 Query: 27 GRYLVSGGTDGVVKVWSL 80 G+YL SGG D ++ +W + Sbjct: 38 GKYLASGGDDNLIMIWQM 55 >SB_30331| Best HMM Match : Amidase (HMM E-Value=0) Length = 555 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +3 Query: 171 NSISIHPYRPILA--TGSGQYHFTDPIKSLVRK 263 NS SI+P+ +L GS QYHF P+ + K Sbjct: 400 NSGSINPFLEMLKYLVGSSQYHFITPVVGSLEK 432 >SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35) Length = 844 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 12 DISPCGRYLVSGGTDGVVKVWSL 80 DISP G L +GG D V+ W L Sbjct: 476 DISPDGTKLWTGGLDNTVRSWDL 498 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,273,350 Number of Sequences: 59808 Number of extensions: 437490 Number of successful extensions: 1163 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 1038 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1163 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -