BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40126 (725 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21520.1 68417.m03110 transducin family protein / WD-40 repea... 55 4e-08 At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p... 42 6e-04 At5g08390.1 68418.m00988 transducin family protein / WD-40 repea... 41 0.001 At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p... 40 0.002 At5g23430.2 68418.m02749 transducin family protein / WD-40 repea... 38 0.005 At5g23430.1 68418.m02748 transducin family protein / WD-40 repea... 38 0.005 At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pf... 36 0.027 At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pf... 36 0.036 At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pf... 36 0.036 At5g45760.2 68418.m05626 transducin family protein / WD-40 repea... 34 0.11 At5g45760.1 68418.m05625 transducin family protein / WD-40 repea... 34 0.11 At5g16750.1 68418.m01961 transducin family protein / WD-40 repea... 34 0.11 At3g21540.1 68416.m02717 transducin family protein / WD-40 repea... 33 0.25 At5g49430.1 68418.m06116 transducin family protein / WD-40 repea... 32 0.45 At5g27570.1 68418.m03302 WD-40 repeat family protein contains 5 ... 32 0.45 At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pf... 31 0.59 At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pf... 31 0.59 At5g25150.1 68418.m02981 transducin family protein / WD-40 repea... 31 0.78 At4g29380.1 68417.m04197 protein kinase family protein / WD-40 r... 31 0.78 At2g18900.1 68415.m02205 transducin family protein / WD-40 repea... 31 0.78 At5g24710.1 68418.m02919 WD-40 repeat family protein contains 3 ... 31 1.0 At2g37160.1 68415.m04559 transducin family protein / WD-40 repea... 31 1.0 At5g17370.1 68418.m02036 WD-40 repeat family protein contains 1 ... 30 1.4 At3g53390.1 68416.m05892 transducin family protein / WD-40 repea... 30 1.8 At2g47410.1 68415.m05917 transducin family protein / WD-40 repea... 30 1.8 At5g54200.1 68418.m06748 WD-40 repeat family protein contains Pf... 29 2.4 At3g18140.1 68416.m02306 transducin family protein / WD-40 repea... 29 2.4 At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pf... 29 2.4 At3g01340.1 68416.m00051 protein transport protein SEC13 family ... 29 2.4 At2g22040.1 68415.m02617 transducin family protein / WD-40 repea... 29 2.4 At1g18080.1 68414.m02238 WD-40 repeat family protein / auxin-dep... 29 2.4 At3g18130.1 68416.m02305 guanine nucleotide-binding family prote... 29 3.1 At2g05720.1 68415.m00613 transducin family protein / WD-40 repea... 29 3.1 At1g64350.1 68414.m07292 transducin family protein / WD-40 repea... 29 3.1 At1g48630.1 68414.m05440 guanine nucleotide-binding family prote... 29 3.1 At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pf... 29 4.1 At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless... 29 4.1 At5g05970.1 68418.m00661 transducin family protein / WD-40 repea... 29 4.1 At3g27640.1 68416.m03452 transducin family protein / WD-40 repea... 29 4.1 At2g47990.1 68415.m06006 transducin family protein / WD-40 repea... 29 4.1 At5g50230.1 68418.m06221 transducin family protein / WD-40 repea... 28 5.5 At2g40480.1 68415.m04996 expressed protein contains Pfam profile... 28 5.5 At2g30050.1 68415.m03654 transducin family protein / WD-40 repea... 28 5.5 At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pf... 28 7.2 At5g14530.1 68418.m01703 transducin family protein / WD-40 repea... 28 7.2 At1g03110.1 68414.m00288 transducin family protein / WD-40 repea... 28 7.2 At5g49650.2 68418.m06145 xylulose kinase, putative similar to D-... 27 9.6 At5g49650.1 68418.m06146 xylulose kinase, putative similar to D-... 27 9.6 At5g27945.1 68418.m03364 transducin family protein / WD-40 repea... 27 9.6 At4g05410.1 68417.m00823 transducin family protein / WD-40 repea... 27 9.6 At3g18910.1 68416.m02401 F-box family protein contains Pfam:PF00... 27 9.6 >At4g21520.1 68417.m03110 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to guanine nucleotide-binding protein beta 5 (GI:1001939) [Mesocricetus auratus] Length = 425 Score = 55.2 bits (127), Expect = 4e-08 Identities = 29/80 (36%), Positives = 41/80 (51%) Frame = +3 Query: 3 IYFDISPCGRYLVSGGTDGVVKVWSLDHIDWHSSLDPVNNTTDDVTYKFPLYKDCCNSIS 182 ++FDI PCGR+L +GG DG+V ++ L +W S ++T N+ S Sbjct: 306 VFFDIEPCGRHLGTGGQDGLVHMYDLQTGNWVSGYQAASDTV--------------NAFS 351 Query: 183 IHPYRPILATGSGQYHFTDP 242 HPY P+ AT SG F P Sbjct: 352 FHPYLPMAATSSGHRRFAIP 371 >At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80 subunit, putative similar to contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 974 Score = 41.5 bits (93), Expect = 6e-04 Identities = 25/69 (36%), Positives = 35/69 (50%) Frame = +3 Query: 12 DISPCGRYLVSGGTDGVVKVWSLDHIDWHSSLDPVNNTTDDVTYKFPLYKDCCNSISIHP 191 + SP GR++VSGG D VVKVW L T + ++F ++ S+ HP Sbjct: 98 EFSPDGRWVVSGGLDNVVKVWDL--------------TAGKLLHEFKCHEGPIRSLDFHP 143 Query: 192 YRPILATGS 218 +LATGS Sbjct: 144 LEFLLATGS 152 >At5g08390.1 68418.m00988 transducin family protein / WD-40 repeat family protein similar to katanin p80 subunit [Strongylocentrotus purpuratus] GI:3005601; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 871 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/67 (35%), Positives = 35/67 (52%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSLDHIDWHSSLDPVNNTTDDVTYKFPLYKDCCNSISIHPYR 197 +P GR++VSGG D VVKVW L T + ++F ++ S+ HP+ Sbjct: 245 TPDGRWIVSGGEDNVVKVWDL--------------TAGKLLHEFKSHEGKIQSLDFHPHE 290 Query: 198 PILATGS 218 +LATGS Sbjct: 291 FLLATGS 297 >At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p80 subunit, putative contains 5 WD-40 repeats (PF00400); similar to katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 1180 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/67 (35%), Positives = 34/67 (50%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSLDHIDWHSSLDPVNNTTDDVTYKFPLYKDCCNSISIHPYR 197 +P GR++VSGG D VVKVW L T + ++F ++ S+ HP Sbjct: 151 TPDGRWVVSGGLDNVVKVWDL--------------TAGKLLHEFKFHEGPIRSLDFHPLE 196 Query: 198 PILATGS 218 +LATGS Sbjct: 197 FLLATGS 203 >At5g23430.2 68418.m02749 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 836 Score = 38.3 bits (85), Expect = 0.005 Identities = 23/67 (34%), Positives = 34/67 (50%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSLDHIDWHSSLDPVNNTTDDVTYKFPLYKDCCNSISIHPYR 197 +P GR++VSGG D +VKVW L T + +F ++ S+ HP+ Sbjct: 152 TPDGRWVVSGGEDNIVKVWDL--------------TAGKLLTEFKSHEGQIQSLDFHPHE 197 Query: 198 PILATGS 218 +LATGS Sbjct: 198 FLLATGS 204 >At5g23430.1 68418.m02748 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 837 Score = 38.3 bits (85), Expect = 0.005 Identities = 23/67 (34%), Positives = 34/67 (50%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSLDHIDWHSSLDPVNNTTDDVTYKFPLYKDCCNSISIHPYR 197 +P GR++VSGG D +VKVW L T + +F ++ S+ HP+ Sbjct: 152 TPDGRWVVSGGEDNIVKVWDL--------------TAGKLLTEFKSHEGQIQSLDFHPHE 197 Query: 198 PILATGS 218 +LATGS Sbjct: 198 FLLATGS 204 >At1g48870.1 68414.m05474 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens]; similar to rab11 binding protein GI:4512103 from [Bos taurus] Length = 593 Score = 35.9 bits (79), Expect = 0.027 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSL 80 SP G+YL +GG DGVVK+W + Sbjct: 207 SPDGKYLATGGEDGVVKIWRI 227 >At5g24320.2 68418.m02866 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 698 Score = 35.5 bits (78), Expect = 0.036 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSL 80 SP GRYL S G DGV++VWS+ Sbjct: 260 SPDGRYLASAGEDGVLRVWSV 280 >At5g24320.1 68418.m02865 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 694 Score = 35.5 bits (78), Expect = 0.036 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSL 80 SP GRYL S G DGV++VWS+ Sbjct: 260 SPDGRYLASAGEDGVLRVWSV 280 >At5g45760.2 68418.m05626 transducin family protein / WD-40 repeat family protein Length = 334 Score = 33.9 bits (74), Expect = 0.11 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +3 Query: 27 GRYLVSGGTDGVVKVWSLDHIDWHSSLDPVNNTTD 131 GR+L+SGG D VK+W D LDP NN + Sbjct: 263 GRFLISGGNDKTVKIW-----DCFKCLDPNNNNNN 292 >At5g45760.1 68418.m05625 transducin family protein / WD-40 repeat family protein Length = 360 Score = 33.9 bits (74), Expect = 0.11 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +3 Query: 27 GRYLVSGGTDGVVKVWSLDHIDWHSSLDPVNNTTD 131 GR+L+SGG D VK+W D LDP NN + Sbjct: 289 GRFLISGGNDKTVKIW-----DCFKCLDPNNNNNN 318 >At5g16750.1 68418.m01961 transducin family protein / WD-40 repeat family protein contains 8 WD-40 repeats (PF00400); similar to transducin homolog sazD - Homo sapiens, EMBL:U02609 Length = 876 Score = 33.9 bits (74), Expect = 0.11 Identities = 23/62 (37%), Positives = 32/62 (51%) Frame = +3 Query: 33 YLVSGGTDGVVKVWSLDHIDWHSSLDPVNNTTDDVTYKFPLYKDCCNSISIHPYRPILAT 212 + VSG D +KVWSLD I S +P+N T V KD NS+++ ++ T Sbjct: 461 FFVSGSGDRTLKVWSLDGIS-EDSEEPINLKTRSVVAAHD--KD-INSVAVARNDSLVCT 516 Query: 213 GS 218 GS Sbjct: 517 GS 518 >At3g21540.1 68416.m02717 transducin family protein / WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (10 copies); similar to WD-repeat protein 3 (SP:Q9UNX4) [Homo sapiens] Length = 955 Score = 32.7 bits (71), Expect = 0.25 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +3 Query: 12 DISPCGRYLVSGGTDGVVKVWSLDHIDWHSSL 107 DIS G +V+G D +K+W LD D H S+ Sbjct: 589 DISSDGELIVTGSQDKNLKIWGLDFGDCHKSI 620 >At5g49430.1 68418.m06116 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein 9 (SP:Q9NSI6) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies) Length = 1677 Score = 31.9 bits (69), Expect = 0.45 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +3 Query: 27 GRYLVSGGTDGVVKVWSLD 83 GRY+++G D +VKVWS+D Sbjct: 257 GRYVITGSDDRLVKVWSMD 275 >At5g27570.1 68418.m03302 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to fizzy1 (GI:3298595) {Xenopus laevis}; similar to "Will die slowly" protein, Drosophia; putative cdc20 protein - Arabidopsis thaliana, EMBL:AF029262 Length = 411 Score = 31.9 bits (69), Expect = 0.45 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSLDHIDWHSSLDPVNNTTDDVTYKFPLYKDCCNSISIHPYR 197 S G+ L SGG D VV +W DH SS N T ++F + +++ P++ Sbjct: 227 SESGKKLASGGNDNVVHIW--DHRSVASS-----NPTRQWLHRFEEHTAAVRALAWCPFQ 279 Query: 198 -PILATGSG 221 +LATG G Sbjct: 280 ASLLATGGG 288 >At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 31.5 bits (68), Expect = 0.59 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSL 80 SP G+Y+ S G D VV+VWS+ Sbjct: 227 SPDGKYIASAGEDCVVRVWSI 247 >At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 31.5 bits (68), Expect = 0.59 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSL 80 SP G+Y+ S G D VV+VWS+ Sbjct: 227 SPDGKYIASAGEDCVVRVWSI 247 >At5g25150.1 68418.m02981 transducin family protein / WD-40 repeat family protein similar to TBP-associated factor (GI:1732075) [Homo sapiens] and to 100 kDa subunit of Pol II transcription factor (GI:1491718) {Homo sapiens]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies)|8689032|gb|AV528749.1|AV528749 Length = 666 Score = 31.1 bits (67), Expect = 0.78 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 15 ISPCGRYLVSGGTDGVVKVWSL 80 +SP GRY+ SG DG + +W L Sbjct: 549 MSPDGRYMASGDEDGTIMMWDL 570 >At4g29380.1 68417.m04197 protein kinase family protein / WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; contains Pfam PF00069: Protein kinase domain; contains PF02985: HEAT repeat; similar to adaptor protein (GI:1817584) [Homo sapiens]; similar to VPS15 protein (GI:6103009) [Pichia pastoris] Length = 1494 Score = 31.1 bits (67), Expect = 0.78 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSL 80 SPCG + VSG + GV+ +W L Sbjct: 1242 SPCGNWFVSGSSRGVLTLWDL 1262 >At2g18900.1 68415.m02205 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); related to LACK protective antigen (GI:13625467) [Leishmania donovani] Length = 804 Score = 31.1 bits (67), Expect = 0.78 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +3 Query: 12 DISPCGRYLVSGGTDGVVKVWSLD 83 + S G YL SGG +GV+ VW LD Sbjct: 290 NFSSDGAYLYSGGREGVLVVWQLD 313 >At5g24710.1 68418.m02919 WD-40 repeat family protein contains 3 Pfam PF00400: WD domain, G-beta repeats; Length = 1327 Score = 30.7 bits (66), Expect = 1.0 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +3 Query: 36 LVSGGTDGVVKVWSLDH 86 LVSGG+DG++ +WS DH Sbjct: 150 LVSGGSDGLLVLWSADH 166 >At2g37160.1 68415.m04559 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to Dystrophia myotonica-containing WD repeat motif protein DMR-N9 protein (DMWD) (DM9) (SP:Q08274) [Mus musculus]; simlar to DMR protein GI:18028289 [Homo sapiens]; Length = 544 Score = 30.7 bits (66), Expect = 1.0 Identities = 10/19 (52%), Positives = 17/19 (89%) Frame = +3 Query: 27 GRYLVSGGTDGVVKVWSLD 83 G+YL++GG D +V+VWS++ Sbjct: 357 GKYLLTGGEDDLVQVWSME 375 >At5g17370.1 68418.m02036 WD-40 repeat family protein contains 1 significant, 2 weak WD-40 repeats (PF00400); similar to transducin beta-like 1 protein.(SP:O60907) [Homo sapiens] Length = 467 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 3 IYFDISPCGRYLVSGGTDGVVKVWSL 80 I F I P R+++SGG D ++WS+ Sbjct: 392 IEFGIDPSERFILSGGDDCYTRIWSI 417 >At3g53390.1 68416.m05892 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to Dystrophia myotonica-containing WD repeat motif protein DMR-N9 protein (DMWD) (DM9) (SP:Q08274) [Mus musculus]; simlar to DMR protein GI:18028289 [Homo sapiens]; Length = 558 Score = 29.9 bits (64), Expect = 1.8 Identities = 9/19 (47%), Positives = 17/19 (89%) Frame = +3 Query: 27 GRYLVSGGTDGVVKVWSLD 83 G+Y+++GG D +V+VWS++ Sbjct: 357 GKYILTGGEDDLVQVWSME 375 >At2g47410.1 68415.m05917 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to WDR protein, form B (GI:14970593) [Mus musculus] Length = 1589 Score = 29.9 bits (64), Expect = 1.8 Identities = 9/19 (47%), Positives = 16/19 (84%) Frame = +3 Query: 27 GRYLVSGGTDGVVKVWSLD 83 GRY+++G D +VK+WS++ Sbjct: 317 GRYVITGSDDRLVKIWSME 335 >At5g54200.1 68418.m06748 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 825 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/57 (28%), Positives = 25/57 (43%) Frame = +3 Query: 27 GRYLVSGGTDGVVKVWSLDHIDWHSSLDPVNNTTDDVTYKFPLYKDCCNSISIHPYR 197 GRYL S G D V+++W + + L ++ D F L +S+ P R Sbjct: 375 GRYLASAGEDCVIQIWKVVESERKGELLSMDKQEDGSINLFLLANGSPEPVSMSPKR 431 Score = 29.1 bits (62), Expect = 3.1 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 6/58 (10%) Frame = +3 Query: 33 YLVSGGTDGVVKVWSL-DH--IDW---HSSLDPVNNTTDDVTYKFPLYKDCCNSISIH 188 Y +SG D V++WS+ DH +DW H + T D YK C + H Sbjct: 523 YFISGSLDAKVRIWSIPDHQVVDWNDLHEMVTAACYTPDGQGALVGSYKGTCCLYNTH 580 >At3g18140.1 68416.m02306 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to Pop3 (GP:3434986) [Schizosaccharomyces pombe] Length = 305 Score = 29.5 bits (63), Expect = 2.4 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +3 Query: 15 ISPCGRYLVSGGTDGVVKVWSLD 83 +SP +YL + +D VK+W++D Sbjct: 219 LSPANKYLATASSDKTVKIWNVD 241 >At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 883 Score = 29.5 bits (63), Expect = 2.4 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 6/57 (10%) Frame = +3 Query: 30 RYLVSGGTDGVVKVWSLDH---IDWHSSLDPVNN---TTDDVTYKFPLYKDCCNSIS 182 RY +SG D V+VWS+ +DW+ + V + T D YK C S Sbjct: 567 RYFISGSLDAKVRVWSIPDRQVVDWYDLHEMVTSACYTPDGQGVLVGSYKGSCRMYS 623 >At3g01340.1 68416.m00051 protein transport protein SEC13 family protein / WD-40 repeat family protein similar to Protein transport protein SEC13 SP|Q04491 {Saccharomyces cerevisiae} and SEC13 (SP:P53024) [Pichia pastoris] Length = 302 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 36 LVSGGTDGVVKVWSLDHIDWHSSLDP-VNNTTD 131 L SGG D VKVW + W P +N TD Sbjct: 179 LASGGCDSTVKVWKFSNGSWKMDCFPALNKHTD 211 >At2g22040.1 68415.m02617 transducin family protein / WD-40 repeat family protein similar to Pop3 (GI:3434986) [Schizosaccharomyces pombe]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies, 2 weak); Length = 312 Score = 29.5 bits (63), Expect = 2.4 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 15 ISPCGRYLVSGGTDGVVKVWSLD 83 +SP +YL + +D VK+W+LD Sbjct: 225 LSPGNKYLATASSDKTVKIWNLD 247 >At1g18080.1 68414.m02238 WD-40 repeat family protein / auxin-dependent protein (ARCA) / guanine nucleotide-binding protein beta subunit, putative identical to SP|O24456 Guanine nucleotide-binding protein beta subunit-like protein (WD-40 repeat auxin-dependent protein ARCA) {Arabidopsis thaliana}; contains 7 WD-40 repeats (PF00400) Length = 327 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 15 ISPCGRYLVSGGTDGVVKVWSL 80 +SP G SGG DGVV +W L Sbjct: 202 VSPDGSLCASGGKDGVVLLWDL 223 >At3g18130.1 68416.m02305 guanine nucleotide-binding family protein / activated protein kinase C receptor (RACK1) identical to guanine nucleotide-binding protein; activated protein kinase C receptor; RACK1 (GI:9294068) {Arabidopsis thaliana}; contains Pfam profile: PF00400 WD domain, G-beta repeat (7 copies) Length = 326 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 15 ISPCGRYLVSGGTDGVVKVWSL 80 +SP G SGG DGV+ +W L Sbjct: 201 VSPDGSLCASGGKDGVILLWDL 222 >At2g05720.1 68415.m00613 transducin family protein / WD-40 repeat family protein Similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (gi:2708305)[Homo sapiens]; contains 4 WD-40 repeats Length = 276 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 12 DISPCGRYLVSGGTDGVVKVWSL 80 D SP G +L SGG D ++W L Sbjct: 179 DFSPNGYHLASGGEDNQCRIWDL 201 >At1g64350.1 68414.m07292 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to nuclear pore protein SEH1 (SP:P53011) [Saccharomyces cerevisiae] Length = 326 Score = 29.1 bits (62), Expect = 3.1 Identities = 14/33 (42%), Positives = 23/33 (69%), Gaps = 3/33 (9%) Frame = +3 Query: 27 GRYLVSGGTDGVVKVWSLD-HIDWH--SSLDPV 116 G L S G+DG+VK+W + + +WH ++L+PV Sbjct: 292 GMTLASTGSDGMVKLWQSNLNGEWHEQATLEPV 324 >At1g48630.1 68414.m05440 guanine nucleotide-binding family protein / activated protein kinase C receptor, putative / RACK, putative contains 7 WD-40 repeats (PF00400); very similar to guanine nucleotide-binding protein; activated protein kinase C receptor; RACK1 (GI:9294068) {Arabidopsis thaliana}; similar to WD-40 repeat auxin-dependent protein ARCA (SP:O24456) [Arabidopsis thaliana]; Length = 326 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 15 ISPCGRYLVSGGTDGVVKVWSL 80 +SP G SGG DGV+ +W L Sbjct: 201 VSPDGSLCASGGKDGVILLWDL 222 >At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 654 Score = 28.7 bits (61), Expect = 4.1 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +3 Query: 27 GRYLVSGGTDGVVKVWSL 80 G++L S G DG+V+VW + Sbjct: 233 GKFLASSGEDGIVRVWKV 250 >At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless protein, putative similar to notchless [Xenopus laevis] GI:3687833; contains Pfam PF00400: WD domain, G-beta repeat (8 copies) Length = 473 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 12 DISPCGRYLVSGGTDGVVKVW 74 D SP G +VSGG D V+K+W Sbjct: 451 DWSPDGEKVVSGGKDRVLKLW 471 >At5g05970.1 68418.m00661 transducin family protein / WD-40 repeat family protein contains similarity to regulatory protein Nedd1; contains Pfam PF00400: WD domain, G-beta repeat (6 copies, 2 weak)|19804256|gb|AV785466.1|AV785466 Length = 781 Score = 28.7 bits (61), Expect = 4.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 30 RYLVSGGTDGVVKVWSL 80 RY+ SGGT +VK+W L Sbjct: 106 RYICSGGTGQIVKIWDL 122 >At3g27640.1 68416.m03452 transducin family protein / WD-40 repeat family protein contains seven WD-40 G-protein beta repeats; similar to RA-regulated nuclear matrix-associated protein (GI:14161320) {Homo sapiens} Length = 535 Score = 28.7 bits (61), Expect = 4.1 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 15 ISPCGRYLVSGGTDGVVKVWSLD 83 ISP G Y++SG +DG +W ++ Sbjct: 346 ISPDGEYVLSGSSDGNAYIWQVN 368 >At2g47990.1 68415.m06006 transducin family protein / WD-40 repeat family protein similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina}; contains 5 WD-40 repeats (PF00400); similar to beta transducin-like protein HET-E2C*4 (GP:17225206)[Podospora anserina] Length = 530 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 33 YLVSGGTDGVVKVWSL 80 +LVSGG DGVVK W + Sbjct: 150 HLVSGGDDGVVKYWDV 165 >At5g50230.1 68418.m06221 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to TIPD PROTEIN (SP:O15736)[Dictyostelium discoideum] Length = 515 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 15 ISPCGRYLVSGGTDGVVKVWSL 80 ISP Y+ +G DG V VWSL Sbjct: 453 ISPDDDYVAAGSADGSVHVWSL 474 >At2g40480.1 68415.m04996 expressed protein contains Pfam profile PF05701: Plant protein of unknown function (DUF827); expression supported by MPSS Length = 541 Score = 28.3 bits (60), Expect = 5.5 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -3 Query: 432 EIHKDSSA*TQRRRFLFNSITSPVHQNVKQFS 337 E+H++ TQRR+F F IT P+ + K+ S Sbjct: 508 EVHEEKQYVTQRRKFGFIHITLPLQKQSKKKS 539 >At2g30050.1 68415.m03654 transducin family protein / WD-40 repeat family protein similar to SEC13-related protein (SP:P55735) [Homo sapiens] Length = 302 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 36 LVSGGTDGVVKVWSLDHIDWHSSLDP 113 L SGG D VKVW L + W P Sbjct: 179 LASGGCDNTVKVWKLANGSWKMDCFP 204 >At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 709 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 Query: 27 GRYLVSGGTDGVVKVWSL 80 G+YL S G D VV+VW++ Sbjct: 269 GKYLASAGEDCVVRVWNI 286 >At5g14530.1 68418.m01703 transducin family protein / WD-40 repeat family protein similar to Will die slowly protein (SP:Q9V3J8) [Drosophila melanogaster] ; contains Pfam PF00400: WD domain, G-beta repeat (4 copies, 1 weak) Length = 330 Score = 27.9 bits (59), Expect = 7.2 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSLDH 86 +P G+Y++SG DG + W++++ Sbjct: 253 TPDGKYVLSGSGDGTLHAWNIEN 275 >At1g03110.1 68414.m00288 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to WD-repeat domain 4 protein (GI:9955698) [Mus musculus] Length = 427 Score = 27.9 bits (59), Expect = 7.2 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSLD 83 S G+ VS G D +VK+WS D Sbjct: 72 STSGKLFVSAGDDKLVKIWSAD 93 >At5g49650.2 68418.m06145 xylulose kinase, putative similar to D-xylulokinase [Pichia stipitis] gi|8100400|gb|AAF72328 Length = 426 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 257 EKTNNEAVDSSSDDSINQYDIRYSSHSENCLTFWWTGD 370 EK A ++ SI+QY ++ +NC+ W+GD Sbjct: 246 EKLGKLAPAYATAGSISQYFVQRFGFEKNCVVVQWSGD 283 >At5g49650.1 68418.m06146 xylulose kinase, putative similar to D-xylulokinase [Pichia stipitis] gi|8100400|gb|AAF72328 Length = 558 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 257 EKTNNEAVDSSSDDSINQYDIRYSSHSENCLTFWWTGD 370 EK A ++ SI+QY ++ +NC+ W+GD Sbjct: 246 EKLGKLAPAYATAGSISQYFVQRFGFEKNCVVVQWSGD 283 >At5g27945.1 68418.m03364 transducin family protein / WD-40 repeat family protein fizzy-related (FZR); contains 6 WD-40 repeats (PF00400); WD-repeat protein, carrot,(gi:2253631) PIR:T14352 Length = 428 Score = 27.5 bits (58), Expect = 9.6 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = +3 Query: 18 SPCGRYLVSGGTDGVVKVWSLDHIDWHSSLDPVNNTTDDVTYKFPLYKDCCNSISIHPYR 197 S G+ L SGG D VV HI W SL +N T ++F + +++ P++ Sbjct: 245 SESGKKLASGGNDNVV------HI-WDRSL-ASSNPTRQWLHRFEEHTAAVRALAWCPFQ 296 Query: 198 -PILATGSG 221 +LATG G Sbjct: 297 ASLLATGGG 305 >At4g05410.1 68417.m00823 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); U3 snoRNP-associated 55-kDa protein, Homo sapiens, gb:NP_004695; Vegetatible incompatibility protein HET-E-1 (SP:Q00808) [Podospora anserina] Length = 504 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 15 ISPCGRYLVSGGTDGVVKVWSLDHIDWHSSLDPVNNTTDDVTYKF 149 +S GRYL +GG D V +W + + + NT + +++ Sbjct: 230 VSSDGRYLATGGVDRHVHIWDVRTREHVQAFPGHRNTVSCLCFRY 274 >At3g18910.1 68416.m02401 F-box family protein contains Pfam:PF00646 F-box domain ; contains TIGRFAM TIGR01640: F-box protein interaction domain ; contains TIGRFAM TIGR01640: F-box protein interaction domain Length = 388 Score = 27.5 bits (58), Expect = 9.6 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +2 Query: 209 YRIWPISFHRPDKIFGEKTNNEAVDSSSDDSINQYDIRYSSHSENCL 349 YRI+PISF+ + +E +D S +S ++I H E L Sbjct: 66 YRIFPISFNLHGNSPSLELKSELIDPHSKNSAAPFEISRVIHCEGLL 112 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,172,255 Number of Sequences: 28952 Number of extensions: 331305 Number of successful extensions: 1049 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1040 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1584903024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -