BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40125 (751 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) 29 3.0 SB_14570| Best HMM Match : Mab-21 (HMM E-Value=0.00069) 29 3.0 SB_42838| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-39) 28 7.0 SB_32903| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) Length = 1049 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 Query: 149 VLKHGQLMTSSEVSAGWSHSASSLICSTSYGTHTLYTGRGPLSLRASG 292 VL +T + GWS + +CS+S G Y R LSL ASG Sbjct: 15 VLTPSLSLTGKSIYDGWSQWSFWNLCSSSCGQGRRYRYRFCLSLTASG 62 >SB_14570| Best HMM Match : Mab-21 (HMM E-Value=0.00069) Length = 639 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = -1 Query: 310 PNVYIKTGGAE*ERPSPSVQSVGTIRGRADEAGC*MRPTSRNFRAGHELTVLQHPK 143 P+V+ + G RP P + + E GC + P R R G LT+ Q+ K Sbjct: 176 PDVWPEPGMDWLVRPRPGGWPLPELIQEIVELGCHLAPVGRGKRTGKTLTIFQYKK 231 >SB_42838| Best HMM Match : 7tm_1 (HMM E-Value=9.4e-39) Length = 747 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 185 VSAGWSHSASSLICSTSYGTHTLYTGRGPLSLRAS 289 ++ GW HS + + +T G HTL T P+ L + Sbjct: 57 LTEGWCHSVNVRLTATKSGRHTL-TNAAPIKLHVT 90 >SB_32903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 765 Score = 27.9 bits (59), Expect = 9.3 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -1 Query: 373 PKITQN*IRASNFPHGLVCPTPNVYIKTGGAE 278 PK T+ +RA PH V P V TGG E Sbjct: 258 PKTTRKPVRAMETPHAEVLIQPKVTGATGGGE 289 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,145,657 Number of Sequences: 59808 Number of extensions: 535973 Number of successful extensions: 1382 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1382 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -