Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV40123
         (703 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292326-1|CAL23138.2|  522|Tribolium castaneum gustatory recept...    22   5.6  
EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive pep...    21   9.7  

>AM292326-1|CAL23138.2|  522|Tribolium castaneum gustatory receptor
           candidate 5 protein.
          Length = 522

 Score = 21.8 bits (44), Expect = 5.6
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = +3

Query: 600 QLLSLSCPFLDGTETTCWSLQPKCLGSKGWQV 695
           QLLSL C F      T  S++P     KG+ +
Sbjct: 4   QLLSLICKFGGWMGLTPVSVEPTGFSPKGYSL 35


>EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive
           peptide receptor 2 protein.
          Length = 354

 Score = 21.0 bits (42), Expect = 9.7
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +3

Query: 330 QRFHQEHDHRNLS 368
           + FH+EHD R  S
Sbjct: 260 RHFHEEHDTRRAS 272


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 172,543
Number of Sequences: 336
Number of extensions: 3789
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18530690
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)