BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40122 (708 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F3.02 |||ER protein translocation subcomplex subunit|Schizo... 27 2.6 SPBC3B9.03 |||signal recognition particle receptor alpha subunit... 25 8.0 >SPAC2F3.02 |||ER protein translocation subcomplex subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 192 Score = 27.1 bits (57), Expect = 2.6 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +1 Query: 241 ANCHFKNKKKYPKCFYR*HEKI-ANRQVQKTLDKQRRK*YLAALTTINSIVTLFA 402 AN K + Y KC+YR + + A ++++ R LA T N +V L+A Sbjct: 132 ANAALKIRNNYGKCYYRKAKALEAMHRIEEAKQVVRDGLILAEPVTRNELVALWA 186 >SPBC3B9.03 |||signal recognition particle receptor alpha subunit Srp101|Schizosaccharomyces pombe|chr 2|||Manual Length = 547 Score = 25.4 bits (53), Expect = 8.0 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 355 YLAALTTINSIVTLFARLIRLHHFTEYVIMFLILF 459 +L+ T+N+ VT ++ T+Y I+F+++F Sbjct: 36 FLSEQRTVNNTVTFDRYTMQYQEATQYSIVFVVVF 70 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,460,581 Number of Sequences: 5004 Number of extensions: 42036 Number of successful extensions: 87 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 87 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -