BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40120 (674 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 6.7 AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding pr... 23 6.7 AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding pr... 23 8.8 AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding pr... 23 8.8 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 8.8 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 8.8 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.4 bits (48), Expect = 6.7 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 7/53 (13%) Frame = +1 Query: 118 LRNRLKYALT--GNEVLKI--VKQRLI---KVDGKDWTDPTYPAGFMDVVSIE 255 + NR+ Y ++ G+E+ +I +K L K+D +D T+P A ++VV+IE Sbjct: 318 INNRIIYGISNNGSELFEIDRLKGSLRTKQKLDREDSTNPINGAFILEVVAIE 370 >AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding protein protein. Length = 155 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/47 (21%), Positives = 23/47 (48%) Frame = +3 Query: 3 EALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 143 ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 35 QSLTQADMDEIAKGMRKVCMSRPKISEEMANYPSQGIFPDDKEFKCY 81 >AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding protein AgamOBP6 protein. Length = 155 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/47 (21%), Positives = 23/47 (48%) Frame = +3 Query: 3 EALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 143 ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 35 QSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDQEFKCY 81 >AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding protein AgamOBP18 protein. Length = 151 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/47 (21%), Positives = 23/47 (48%) Frame = +3 Query: 3 EALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 143 ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 31 QSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDKEFKCY 77 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 8.8 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 477 KIMDFIKFESGTCV*SLDAVTXCVWAPSCSA 569 K +DF + V LD +T CV S SA Sbjct: 2360 KAIDFCYHDEDEMVTVLDCITLCVMVVSYSA 2390 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.0 bits (47), Expect = 8.8 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 383 SVLGNAXWLHHPLXRPTYQSQRFH 454 SVLGN LH + Q +RFH Sbjct: 209 SVLGNGIQLHRHQHQLQPQQRRFH 232 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 732,358 Number of Sequences: 2352 Number of extensions: 14697 Number of successful extensions: 38 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -