BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40117 (819 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0821 - 11519840-11519989,11520333-11520476,11520556-115207... 29 5.9 >03_02_0821 - 11519840-11519989,11520333-11520476,11520556-11520754, 11521309-11521412,11521488-11521598,11521653-11521771, 11521858-11522002,11522516-11522568,11522676-11522721, 11522818-11522963,11523691-11523760,11524930-11525083, 11525186-11525307,11525612-11525835,11526317-11526371, 11526793-11526972 Length = 673 Score = 28.7 bits (61), Expect = 5.9 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = -3 Query: 811 WNLRPILDPAGPSIHKT---LSNWSTLCFSL*KW*NSRSGVEVLK-KIINLFKNK 659 W L D +G ++H +SN+ L S W NS G LK K++N F NK Sbjct: 530 WMLHFFKDSSGATLHPLTIQVSNYDQLAASALTWQNSNDGNTYLKIKVVN-FGNK 583 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,634,027 Number of Sequences: 37544 Number of extensions: 368493 Number of successful extensions: 638 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 638 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2244686244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -