BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40116 (845 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_02_0115 - 11248021-11248101,11249017-11249118 56 3e-08 05_03_0661 - 16726958-16726966,16727133-16727234 56 4e-08 >01_02_0115 - 11248021-11248101,11249017-11249118 Length = 60 Score = 56.4 bits (130), Expect = 3e-08 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 32 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGV 136 MAKSKNHT HNQ+ KAH+NGIKKP++ R ST G+ Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRQTSTKGM 35 >05_03_0661 - 16726958-16726966,16727133-16727234 Length = 36 Score = 56.0 bits (129), Expect = 4e-08 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +2 Query: 32 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLG 133 MAKSKNHT HNQ+ KAH+NGIKKP++ R ST G Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRQTSTKG 34 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,937,257 Number of Sequences: 37544 Number of extensions: 296986 Number of successful extensions: 521 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 521 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2350456800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -