BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40111 (785 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 26 0.39 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 2.8 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 2.8 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 6.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 6.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 6.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 6.4 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 8.4 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 25.8 bits (54), Expect = 0.39 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 3/25 (12%) Frame = +3 Query: 669 DDEDSFKR---QFSKYIKLGVTADA 734 +D+D +K+ QFSK IKLG+ D+ Sbjct: 418 EDKDGYKKFYEQFSKNIKLGIHEDS 442 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +2 Query: 491 LLVLVSWSYEGCC*RWPQCSSFHQKIPWL*CRIQ 592 LL+ WS W CSSF Q+ C I+ Sbjct: 397 LLLDADWSVNAGMWMWLSCSSFFQQFFHCYCPIK 430 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/48 (22%), Positives = 24/48 (50%) Frame = +2 Query: 80 QVKFKRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQV 223 + +FK + +A+K +VV+DK K + + + + + D C + Sbjct: 198 KTRFKTINNILENLWAKKLIVVKDKKKSRSDEQTIDICMRCHDQLCDM 245 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.4 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 2/63 (3%) Frame = -2 Query: 361 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRTNMVTFNPRVGHLACYIFVG--ETH 188 +A + IAD L ML L + + H++++R+ + HL G E+ Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRSMSASSRGDHHHLGAVTEEGGDESA 1190 Query: 187 NQT 179 N+T Sbjct: 1191 NET 1193 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.4 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 2/63 (3%) Frame = -2 Query: 361 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRTNMVTFNPRVGHLACYIFVG--ETH 188 +A + IAD L ML L + + H++++R+ + HL G E+ Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRSMSASSRGDHHHLGAVTEEGGDESA 1190 Query: 187 NQT 179 N+T Sbjct: 1191 NET 1193 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.4 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 2/63 (3%) Frame = -2 Query: 361 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRTNMVTFNPRVGHLACYIFVG--ETH 188 +A + IAD L ML L + + H++++R+ + HL G E+ Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRSMSASSRGDHHHLGAVTEEGGDESA 1190 Query: 187 NQT 179 N+T Sbjct: 1191 NET 1193 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.4 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 2/63 (3%) Frame = -2 Query: 361 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNKQRTNMVTFNPRVGHLACYIFVG--ETH 188 +A + IAD L ML L + + H++++R+ + HL G E+ Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRSMSASSRGDHHHLGAVTEEGGDESA 1190 Query: 187 NQT 179 N+T Sbjct: 1191 NET 1193 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.4 bits (43), Expect = 8.4 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -2 Query: 361 EAVFVLIADQLNMLQHNLSDQPSHHNVATHVNK 263 E + +L ++ LNM Q + SH ++ VN+ Sbjct: 301 EQMNLLHSNDLNMHQQHHQQNMSHEELSAMVNR 333 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,288 Number of Sequences: 336 Number of extensions: 4080 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21272645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -