BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40106 (814 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069164-1|AAL39309.1| 545|Drosophila melanogaster GH19483p pro... 30 3.3 AE014298-2972|AAF45368.1| 545|Drosophila melanogaster CG9581-PA... 30 3.3 AY070987-1|AAL48609.1| 252|Drosophila melanogaster RE08075p pro... 29 5.7 AE014297-3562|AAF56308.2| 252|Drosophila melanogaster CG13618-P... 29 5.7 >AY069164-1|AAL39309.1| 545|Drosophila melanogaster GH19483p protein. Length = 545 Score = 30.3 bits (65), Expect = 3.3 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = -2 Query: 609 IHQNCPKVD*QFKNIYY*VENDLSISGTANRSVCIETCLKD 487 I Q+C V +F+ I +E+DL I+ + V E C+KD Sbjct: 482 IGQDCGDVPPEFRGIGIRIEDDLLINENGHVEVLTEACVKD 522 >AE014298-2972|AAF45368.1| 545|Drosophila melanogaster CG9581-PA protein. Length = 545 Score = 30.3 bits (65), Expect = 3.3 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = -2 Query: 609 IHQNCPKVD*QFKNIYY*VENDLSISGTANRSVCIETCLKD 487 I Q+C V +F+ I +E+DL I+ + V E C+KD Sbjct: 482 IGQDCGDVPPEFRGIGIRIEDDLLINENGHVEVLTEACVKD 522 >AY070987-1|AAL48609.1| 252|Drosophila melanogaster RE08075p protein. Length = 252 Score = 29.5 bits (63), Expect = 5.7 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = +1 Query: 37 YAQSNWDQIGTNVANKIFSKVPYDQIFLA 123 YA+S + I ++NK+F KVP+D IFL+ Sbjct: 225 YAKS-FGIIFRELSNKLFEKVPFDNIFLS 252 >AE014297-3562|AAF56308.2| 252|Drosophila melanogaster CG13618-PA protein. Length = 252 Score = 29.5 bits (63), Expect = 5.7 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = +1 Query: 37 YAQSNWDQIGTNVANKIFSKVPYDQIFLA 123 YA+S + I ++NK+F KVP+D IFL+ Sbjct: 225 YAKS-FGIIFRELSNKLFEKVPFDNIFLS 252 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,146,241 Number of Sequences: 53049 Number of extensions: 659321 Number of successful extensions: 1205 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1190 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1205 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3818998872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -