BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40102 (496 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 7.2 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 9.5 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 21 9.5 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 9.5 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 9.5 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 157 PTELRIFSTSAAAGVVLPPS 98 P E STS ++G++ P S Sbjct: 304 PAEAESLSTSGSSGILTPVS 323 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 20.6 bits (41), Expect = 9.5 Identities = 10/42 (23%), Positives = 22/42 (52%) Frame = -1 Query: 229 ISCSTSLPLSSVITFLSFSPSASIPTELRIFSTSAAAGVVLP 104 ++C++S+ S V++ P+A + + S A V++P Sbjct: 156 VNCTSSIASSGVVSAGECGPAADVDEKTDANSWWALILVIVP 197 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 132 VEKILSSVGIEADGEKLKKVITELNGK 212 V K + +GI +K+K ++ EL K Sbjct: 28 VGKGMKVIGIAPQVDKMKTLVEELKSK 54 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 20.6 bits (41), Expect = 9.5 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -1 Query: 250 SFSRPAAISCSTSLPLSSVITFLSFSPSASIPT 152 SF+ A + S+P +++IT L + +PT Sbjct: 428 SFTATLASIGAASIPSAALITMLIVLTALGLPT 460 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 20.6 bits (41), Expect = 9.5 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = -1 Query: 487 YFIETHSPSCYS*NINWNSVQRRVLL*SLVKETEAHVI 374 YF + + I W SVQ+ V + + TE ++ Sbjct: 76 YFSSIRRLNSEAHRIRWESVQKEVTVTGTYQLTETELV 113 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,578 Number of Sequences: 438 Number of extensions: 1472 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13667319 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -