BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40101 (838 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52347| Best HMM Match : TPR_1 (HMM E-Value=0) 31 1.5 SB_32009| Best HMM Match : PKD (HMM E-Value=1.9e-19) 28 8.2 >SB_52347| Best HMM Match : TPR_1 (HMM E-Value=0) Length = 687 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = -1 Query: 106 FFQLHIILVRYLGFLINKLIIYIVHGLINNPVSV 5 F ++II+V + +IN +II IV+ +INN + + Sbjct: 252 FTNINIIIVNIIIIIINNIIIIIVNIIINNNIDI 285 >SB_32009| Best HMM Match : PKD (HMM E-Value=1.9e-19) Length = 3083 Score = 28.3 bits (60), Expect = 8.2 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -3 Query: 383 LFLMLSITCLAYQSKGNQSDSLVMIG 306 LF + +C+ Y KG DS++MIG Sbjct: 2478 LFCTMVTSCMFYNIKGAADDSIIMIG 2503 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,450,180 Number of Sequences: 59808 Number of extensions: 295140 Number of successful extensions: 432 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 431 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2359470773 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -