BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40098 (858 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1529 + 27491963-27492465,27493045-27493154,27493384-274935... 30 2.7 05_05_0348 + 24271764-24271898,24273055-24273144,24273205-242733... 28 8.3 >07_03_1529 + 27491963-27492465,27493045-27493154,27493384-27493510, 27494082-27494430,27494975-27495251,27496236-27496333, 27498090-27498214,27498270-27498326,27498328-27498370, 27498581-27498667,27498802-27498882,27499735-27499901, 27499987-27500098,27500188-27500390,27500473-27500607, 27501106-27501205 Length = 857 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/53 (28%), Positives = 26/53 (49%) Frame = -2 Query: 647 FIYKF*CLFQILRSSFLTK*YVLCISHLFLFSSHINLLVFFWFWHVCVLASVK 489 F+Y+ CLF+ + F + I + L+ +HI L+ F W +L S + Sbjct: 547 FMYELGCLFRYCQHPFYHCVDISVILYSELYLAHIKLICLFHLWQNLILFSYR 599 >05_05_0348 + 24271764-24271898,24273055-24273144,24273205-24273303, 24273725-24273826,24273912-24274088,24274193-24274398, 24274491-24274575,24274641-24274798,24274873-24274948, 24275117-24275245,24275313-24275457,24275561-24275691, 24276183-24276335,24276447-24276636,24277006-24277139, 24277248-24277406,24277659-24277964,24278040-24278216, 24278446-24278529,24278592-24278822,24278913-24279002, 24279090-24279211,24279293-24279448,24279477-24279635, 24279705-24279765,24280004-24280138,24280384-24280471, 24280548-24280620,24280883-24280994,24281691-24281711 Length = 1327 Score = 28.3 bits (60), Expect = 8.3 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +1 Query: 451 VNN*NGEL*KYYYLTLANTQT--CQNQKKTNKLMCELNRKRCEIHNTYYLVRK 603 + N G++ K L +AN Q+ C N+++ +K ++NR + I LV+K Sbjct: 892 IENAGGQVLKDQKLKVANIQSILCVNRQQLDKTSSDINRHKVRITTCEKLVKK 944 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,450,226 Number of Sequences: 37544 Number of extensions: 344720 Number of successful extensions: 528 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 528 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2397465936 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -