BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40097 (845 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0038 + 31227349-31227621,31228120-31228212,31229439-312295... 29 4.7 01_01_1149 - 9134390-9134600,9134732-9134790,9135650-9135724,913... 29 6.2 >03_06_0038 + 31227349-31227621,31228120-31228212,31229439-31229575, 31229953-31231030,31231757-31232374 Length = 732 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +3 Query: 6 NGGAATMPSRPGPHVSKLLIHVHK*TQKYQSTMS 107 NGGAA +P PGP +L H+H + +TMS Sbjct: 246 NGGAARLP--PGPPAVPILGHLHLVKKPMHATMS 277 >01_01_1149 - 9134390-9134600,9134732-9134790,9135650-9135724, 9135815-9135934,9136012-9136183,9136277-9136335, 9136516-9136572,9136900-9136998,9137088-9137114, 9137607-9137649,9137779-9138023 Length = 388 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -1 Query: 326 SLFTDRTPASYASLVLLKNQYSIVASMNLFTSL 228 SL ++ +PA YA+ L+KN S+V M+L + Sbjct: 212 SLVSEFSPAQYAASPLIKNSLSVVPWMSLLLGM 244 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,995,754 Number of Sequences: 37544 Number of extensions: 433669 Number of successful extensions: 728 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 728 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2350456800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -