BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40097 (845 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341178-1|AAR13742.1| 230|Anopheles gambiae ferredoxin reducta... 24 6.7 AY341177-1|AAR13741.1| 230|Anopheles gambiae ferredoxin reducta... 24 6.7 AY341176-1|AAR13740.1| 230|Anopheles gambiae ferredoxin reducta... 24 6.7 AY341175-1|AAR13739.1| 230|Anopheles gambiae ferredoxin reducta... 24 6.7 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 8.8 >AY341178-1|AAR13742.1| 230|Anopheles gambiae ferredoxin reductase protein. Length = 230 Score = 23.8 bits (49), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 279 EYQGRIARRSSVGKKTP 329 +Y GR+A + +GK TP Sbjct: 125 QYHGRVAALNMIGKATP 141 >AY341177-1|AAR13741.1| 230|Anopheles gambiae ferredoxin reductase protein. Length = 230 Score = 23.8 bits (49), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 279 EYQGRIARRSSVGKKTP 329 +Y GR+A + +GK TP Sbjct: 125 QYHGRVAALNMIGKATP 141 >AY341176-1|AAR13740.1| 230|Anopheles gambiae ferredoxin reductase protein. Length = 230 Score = 23.8 bits (49), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 279 EYQGRIARRSSVGKKTP 329 +Y GR+A + +GK TP Sbjct: 125 QYHGRVAALNMIGKATP 141 >AY341175-1|AAR13739.1| 230|Anopheles gambiae ferredoxin reductase protein. Length = 230 Score = 23.8 bits (49), Expect = 6.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 279 EYQGRIARRSSVGKKTP 329 +Y GR+A + +GK TP Sbjct: 125 QYHGRVAALNMIGKATP 141 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 23.4 bits (48), Expect = 8.8 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -2 Query: 211 RIRMRRAHRPSGIKWSSASSLIQSL*RALYKHLLPLIVL 95 R ++RAHRP ++ +SA + + + PL++L Sbjct: 801 RKSVQRAHRPGALRVASAFQTVSYDAACVVANTTPLVLL 839 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 897,348 Number of Sequences: 2352 Number of extensions: 19457 Number of successful extensions: 32 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 89718867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -