BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40092 (808 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1568 - 27788314-27788619,27789125-27789294,27789868-277899... 31 1.1 04_04_0808 - 28196563-28196735,28197369-28197440,28197540-281976... 29 5.8 >07_03_1568 - 27788314-27788619,27789125-27789294,27789868-27789979, 27790063-27790117,27790201-27790316,27790731-27790812, 27790974-27791228,27791326-27791454,27791539-27791747 Length = 477 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +2 Query: 83 IHFYIYRLMQCYFIAWQIFILSVTYYFLILDMPS 184 +H + R +CY I W+ +++VT +++LD P+ Sbjct: 189 VHVHPKRFPRCYEIDWKSRVIAVTDNYVVLDKPA 222 >04_04_0808 - 28196563-28196735,28197369-28197440,28197540-28197666, 28198362-28198430,28198517-28198583,28198751-28198872, 28199302-28199412,28199596-28199661,28200156-28200213, 28200307-28200343,28200420-28200513,28200967-28201032, 28201139-28201203,28201352-28201496,28201925-28202074, 28202266-28202335,28202752-28202828,28202919-28202987, 28203798-28203881,28204018-28204061,28204172-28204273, 28204420-28204618,28204672-28204727,28204886-28204958, 28205685-28205771,28205863-28205976,28206985-28207092, 28207183-28207278,28207722-28207787,28208130-28208222, 28208429-28208512,28208961-28209078,28209191-28209267, 28209459-28209641,28210542-28210636,28210903-28211053, 28212218-28212325,28212513-28212612,28212788-28212840, 28214022-28214102 Length = 1269 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -3 Query: 668 MIYLVPPTK*SSIQXIEKLTKAHGRCHLNGCNRQ*IDNKI 549 +++LVPPT+ ++ A G C + G Q D K+ Sbjct: 28 LVFLVPPTRAQQSNGTSRVVPAEGYCSMYGICAQRSDGKV 67 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,506,569 Number of Sequences: 37544 Number of extensions: 329379 Number of successful extensions: 526 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 521 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 526 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2197677108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -