BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40092 (808 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18371| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_24152| Best HMM Match : PKD (HMM E-Value=4.1e-29) 28 7.7 >SB_18371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 264 Score = 28.7 bits (61), Expect = 5.9 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 327 TCNKNNEISRWTQKKIT 377 TCN N+E+SRWT+ T Sbjct: 127 TCNDNDEVSRWTKTIFT 143 >SB_24152| Best HMM Match : PKD (HMM E-Value=4.1e-29) Length = 1130 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +1 Query: 238 KNSNRSYEIGNRSLVEIAKQFNISKSV--LHRHVTRTMK 348 +N ++YEI + I K FNISK+ RHV +K Sbjct: 437 RNGGKAYEISSLDSSHIIKGFNISKATPRTERHVEYLLK 475 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,158,958 Number of Sequences: 59808 Number of extensions: 416779 Number of successful extensions: 978 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 930 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 978 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2239700683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -