BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40092 (808 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 24 1.4 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 22 5.8 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 22 5.8 AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 22 7.7 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 22 7.7 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 24.2 bits (50), Expect = 1.4 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = +2 Query: 392 IFSEWGYPLDSYDLLIIIMGLLDRVRIKIKRFTDNLPGVIILRL 523 + + G P + LL + +LDR+R I D I+ L Sbjct: 452 VLTALGLPTNDISLLFAVDWMLDRIRTSINVLGDGYGAGIVYHL 495 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 22.2 bits (45), Expect = 5.8 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 147 DNINICQAMK*HCINL 100 D +N CQA+ HC +L Sbjct: 31 DGMNQCQAVNGHCSHL 46 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 22.2 bits (45), Expect = 5.8 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 147 DNINICQAMK*HCINL 100 D +N CQA+ HC +L Sbjct: 31 DGMNQCQAVNGHCSHL 46 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 21.8 bits (44), Expect = 7.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 775 KNGXSLFRRTRLGLRGMK 722 ++G F+R R+G GM+ Sbjct: 246 ESGSESFKRARMGFHGMR 263 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 21.8 bits (44), Expect = 7.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 775 KNGXSLFRRTRLGLRGMK 722 ++G F+R R+G GM+ Sbjct: 246 ESGSESFKRARMGFHGMR 263 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,507 Number of Sequences: 438 Number of extensions: 4295 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25610547 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -