BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40091 (492 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 2.6 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 21 4.6 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 21 4.6 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 6.1 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 8.0 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 8.0 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.2 bits (45), Expect = 2.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 253 RRYPTPSRERERCPSH 300 RR P P+R R P+H Sbjct: 329 RRGPGPARSRRHLPAH 344 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.4 bits (43), Expect = 4.6 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 312 VRKEIKDQSEGTQDAENK*GGFAMVHFNLF 401 V K+I+D G ++EN F ++H + + Sbjct: 347 VAKKIRDFYYGGPNSENNLDNFYLIHTDTY 376 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 21.4 bits (43), Expect = 4.6 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 312 VRKEIKDQSEGTQDAENK*GGFAMVHFNLF 401 V K+I+D G ++EN F ++H + + Sbjct: 349 VAKKIRDFYYGGPNSENNLDNFYLIHTDTY 378 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.0 bits (42), Expect = 6.1 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 Query: 32 TKSIWTCSTSRRKR 73 T+ IW CS RK+ Sbjct: 1169 TEGIWICSLIHRKK 1182 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 20.6 bits (41), Expect = 8.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 427 ISLIQTILWNKLKCTIAKPPYL 362 +S I +W+KL T KPP L Sbjct: 110 VSCISEEVWSKLIETGNKPPTL 131 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 20.6 bits (41), Expect = 8.0 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = -3 Query: 394 LKCTIAKPPYLFSASW 347 ++CT++K Y + SW Sbjct: 623 VQCTVSKGDYPLNISW 638 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,862 Number of Sequences: 336 Number of extensions: 2058 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11525470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -