BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40087 (855 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 24 1.8 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.3 AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical pro... 22 5.4 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 7.1 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 7.1 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 618 PFRTANAQSFNGYYWGSF 671 PFR + S+ GY+ GS+ Sbjct: 75 PFRPMHQNSYTGYHLGSY 92 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.4 bits (48), Expect = 2.3 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -3 Query: 610 YFSFLNFIQ*FYVFEVSLIDKGRTVFFTCAVKPIICEPIFC 488 Y+ L F F +F + L+ +F CA+ ++C FC Sbjct: 262 YYMHLLFCCAFIIFTMHLLFLLCIYYFYCALIILLCIYYFC 302 >AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical protein protein. Length = 95 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 727 IIGPLDSGGPRYDRIGKFPRVKK 795 +IG + SGGP + K+P +K Sbjct: 45 VIGGITSGGPIPTKSSKYPIKRK 67 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 34 HTAHLMVSGYRRPWTSAMPGAEPS 105 +T H+ G+ P+T M G E S Sbjct: 486 YTIHMGYHGFHNPFTCNMCGVECS 509 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 70 GDGNHSPSGGP 38 G GN+ P GGP Sbjct: 530 GSGNNQPPGGP 540 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,463 Number of Sequences: 336 Number of extensions: 4666 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23659332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -