BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40087 (855 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0460 - 17955102-17955146,17955253-17955310,17955442-179555... 28 8.3 >11_04_0460 - 17955102-17955146,17955253-17955310,17955442-17955593, 17955888-17955993,17956101-17956222,17956766-17956834, 17956969-17957214,17957331-17957373,17957449-17957520, 17957954-17958066,17958158-17958238,17958343-17958415, 17959413-17959519,17960410-17960514,17960684-17960974, 17961621-17961707,17961774-17961842,17961917-17961973, 17962057-17962155,17962223-17962312,17962395-17962511, 17964164-17964244,17964353-17964502,17964812-17964956, 17967359-17967510,17967647-17967784,17967838-17967914, 17968032-17968134 Length = 1015 Score = 28.3 bits (60), Expect = 8.3 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Frame = +3 Query: 381 KKYSKTHTVYRKQKCSLEGFFIALLFAPY----ELYYKVVQKIGSQI 509 K YS + KQ C + G I L PY + YY++V++IG +I Sbjct: 323 KYYSMISAKHHKQICEILGELITL--KPYIKGSDHYYEIVERIGEKI 367 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,579,826 Number of Sequences: 37544 Number of extensions: 447474 Number of successful extensions: 767 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 767 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2385713652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -